BLASTX nr result
ID: Magnolia22_contig00035702
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00035702 (442 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008790235.1 PREDICTED: putative pentatricopeptide repeat-cont... 79 3e-14 XP_010936130.1 PREDICTED: putative pentatricopeptide repeat-cont... 73 4e-12 XP_020095877.1 putative pentatricopeptide repeat-containing prot... 69 6e-11 XP_006856131.1 PREDICTED: putative pentatricopeptide repeat-cont... 66 7e-10 XP_012699838.1 PREDICTED: putative pentatricopeptide repeat-cont... 65 2e-09 KQL16145.1 hypothetical protein SETIT_024660mg, partial [Setaria... 65 2e-09 XP_010274884.1 PREDICTED: putative pentatricopeptide repeat-cont... 63 8e-09 OAY72532.1 putative pentatricopeptide repeat-containing protein,... 62 1e-08 ONM59770.1 Putative pentatricopeptide repeat-containing protein ... 59 1e-08 XP_020185681.1 putative pentatricopeptide repeat-containing prot... 62 2e-08 EMT06399.1 hypothetical protein F775_16833 [Aegilops tauschii] 62 2e-08 KXG36729.1 hypothetical protein SORBI_002G380100 [Sorghum bicolor] 60 7e-08 ONK75973.1 uncharacterized protein A4U43_C03F22500 [Asparagus of... 60 1e-07 ONM59774.1 Putative pentatricopeptide repeat-containing protein ... 59 2e-07 ONM59772.1 Putative pentatricopeptide repeat-containing protein ... 59 2e-07 ONM59775.1 Putative pentatricopeptide repeat-containing protein ... 59 2e-07 XP_018685303.1 PREDICTED: putative pentatricopeptide repeat-cont... 59 3e-07 BAH93045.1 Os05g0275100, partial [Oryza sativa Japonica Group] 57 5e-07 AAT85126.1 hypothetical protein [Oryza sativa Japonica Group] 57 1e-06 EEC78894.1 hypothetical protein OsI_19266 [Oryza sativa Indica G... 57 1e-06 >XP_008790235.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Phoenix dactylifera] Length = 952 Score = 79.0 bits (193), Expect = 3e-14 Identities = 38/65 (58%), Positives = 46/65 (70%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPAIMSDRKMGQVKPIDVKEHTRDTYN 263 N+VT+STLVQGYIRC D QISKLY+EMH+RGL PA+ MG +P+ VK T N Sbjct: 885 NYVTYSTLVQGYIRCMDMHQISKLYEEMHIRGLFPAVAFKGNMGPAEPMAVKGIKHGTIN 944 Query: 262 MSEAI 248 +SE I Sbjct: 945 LSEHI 949 >XP_010936130.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Elaeis guineensis] XP_010936131.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Elaeis guineensis] Length = 955 Score = 72.8 bits (177), Expect = 4e-12 Identities = 36/65 (55%), Positives = 43/65 (66%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPAIMSDRKMGQVKPIDVKEHTRDTYN 263 N+VT+STLV YIRC D QISKLY+EMH+RGL PA+ MG +PI VK DT Sbjct: 888 NYVTYSTLVWRYIRCMDMHQISKLYEEMHIRGLFPAVAFKGNMGPAEPIAVKGTKHDTVK 947 Query: 262 MSEAI 248 + E I Sbjct: 948 LFEHI 952 >XP_020095877.1 putative pentatricopeptide repeat-containing protein At1g19290 [Ananas comosus] XP_020095887.1 putative pentatricopeptide repeat-containing protein At1g19290 [Ananas comosus] XP_020095894.1 putative pentatricopeptide repeat-containing protein At1g19290 [Ananas comosus] XP_020095902.1 putative pentatricopeptide repeat-containing protein At1g19290 [Ananas comosus] XP_020095911.1 putative pentatricopeptide repeat-containing protein At1g19290 [Ananas comosus] XP_020095920.1 putative pentatricopeptide repeat-containing protein At1g19290 [Ananas comosus] Length = 949 Score = 69.3 bits (168), Expect = 6e-11 Identities = 30/62 (48%), Positives = 44/62 (70%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPAIMSDRKMGQVKPIDVKEHTRDTYN 263 N+VT+ TL+QGYIRCG+ +Q+SKLY+EMH+RGL PA + Q +P K+ D+Y Sbjct: 882 NYVTYWTLIQGYIRCGNLKQVSKLYEEMHIRGLFPAFPFKGNIYQAEPAAKKQVQHDSYQ 941 Query: 262 MS 257 ++ Sbjct: 942 VA 943 >XP_006856131.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Amborella trichopoda] ERN17598.1 hypothetical protein AMTR_s00059p00156460 [Amborella trichopoda] Length = 962 Score = 66.2 bits (160), Expect = 7e-10 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPAIMSDRKMGQVKPID 293 NFVT+STLVQGYI+ GD QISKLYDEMH++GLLP ++ Q D Sbjct: 906 NFVTYSTLVQGYIQSGDMGQISKLYDEMHIKGLLPGVLDHETTSQSNNFD 955 >XP_012699838.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] XP_012699839.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] XP_012699840.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] XP_012699841.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] XP_012699842.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Setaria italica] Length = 933 Score = 65.1 bits (157), Expect = 2e-09 Identities = 31/62 (50%), Positives = 43/62 (69%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPAIMSDRKMGQVKPIDVKEHTRDTYN 263 N+VT+ TL+QGYIRCG+ ++ISKLYDEMH+RGLLP +++ DVK+ YN Sbjct: 871 NYVTYWTLIQGYIRCGNMKEISKLYDEMHIRGLLPTLVAG---------DVKQACPVIYN 921 Query: 262 MS 257 + Sbjct: 922 QN 923 >KQL16145.1 hypothetical protein SETIT_024660mg, partial [Setaria italica] Length = 728 Score = 64.7 bits (156), Expect = 2e-09 Identities = 26/39 (66%), Positives = 36/39 (92%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPAIMS 326 N+VT+ TL+QGYIRCG+ ++ISKLYDEMH+RGLLP +++ Sbjct: 688 NYVTYWTLIQGYIRCGNMKEISKLYDEMHIRGLLPTLVA 726 >XP_010274884.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Nelumbo nucifera] XP_010274885.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Nelumbo nucifera] XP_010274886.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Nelumbo nucifera] Length = 955 Score = 63.2 bits (152), Expect = 8e-09 Identities = 32/66 (48%), Positives = 44/66 (66%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPAIMSDRKMGQVKPIDVKEHTRDTYN 263 N VT+ TLVQG IR D +Q+S L DEM VRGL I+S ++MG +P+D K+ + Y Sbjct: 891 NIVTYCTLVQGCIRFRDLKQVSNLNDEMQVRGLSSGIVSHKQMGLTEPVDDKD-MPNVYG 949 Query: 262 MSEAIC 245 M +A+C Sbjct: 950 MPDAVC 955 >OAY72532.1 putative pentatricopeptide repeat-containing protein, partial [Ananas comosus] Length = 366 Score = 62.4 bits (150), Expect = 1e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPA 335 N+VT+ TL+QGYIRCG+ +Q+SKLY+EMH+RGL PA Sbjct: 300 NYVTYWTLIQGYIRCGNLKQVSKLYEEMHIRGLFPA 335 >ONM59770.1 Putative pentatricopeptide repeat-containing protein [Zea mays] Length = 108 Score = 58.9 bits (141), Expect = 1e-08 Identities = 28/66 (42%), Positives = 41/66 (62%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPAIMSDRKMGQVKPIDVKEHTRDTYN 263 N+VT+ TL+QGY+RCG+ +ISK+YD+MH+ GLLP +S DVK+ +N Sbjct: 44 NYVTYWTLIQGYVRCGNMIEISKIYDKMHIHGLLPTNVSG---------DVKQSCPAIHN 94 Query: 262 MSEAIC 245 + C Sbjct: 95 PNRETC 100 >XP_020185681.1 putative pentatricopeptide repeat-containing protein At1g19290 [Aegilops tauschii subsp. tauschii] Length = 934 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/36 (69%), Positives = 34/36 (94%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPA 335 N+VT+ TL+QGY+RCG+ ++ISKLY+EMH+RGLLPA Sbjct: 874 NYVTYWTLIQGYVRCGNMKEISKLYNEMHIRGLLPA 909 >EMT06399.1 hypothetical protein F775_16833 [Aegilops tauschii] Length = 1046 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/36 (69%), Positives = 34/36 (94%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPA 335 N+VT+ TL+QGY+RCG+ ++ISKLY+EMH+RGLLPA Sbjct: 874 NYVTYWTLIQGYVRCGNMKEISKLYNEMHIRGLLPA 909 >KXG36729.1 hypothetical protein SORBI_002G380100 [Sorghum bicolor] Length = 602 Score = 60.5 bits (145), Expect = 7e-08 Identities = 29/66 (43%), Positives = 41/66 (62%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPAIMSDRKMGQVKPIDVKEHTRDTYN 263 N+VT+ TL+QGY+RCG+ +ISK+YD+MH+RGLL + P DVK+ YN Sbjct: 538 NYVTYWTLIQGYVRCGNMIEISKIYDKMHIRGLLSTNV---------PGDVKQSCPAVYN 588 Query: 262 MSEAIC 245 + C Sbjct: 589 QNRNTC 594 >ONK75973.1 uncharacterized protein A4U43_C03F22500 [Asparagus officinalis] Length = 1022 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPAI 332 N+VT+STLV YIRC + QQ+S+LYD+MH+RGLLP + Sbjct: 874 NYVTYSTLVHSYIRCRNLQQVSRLYDQMHIRGLLPEV 910 >ONM59774.1 Putative pentatricopeptide repeat-containing protein [Zea mays] Length = 484 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/66 (42%), Positives = 41/66 (62%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPAIMSDRKMGQVKPIDVKEHTRDTYN 263 N+VT+ TL+QGY+RCG+ +ISK+YD+MH+ GLLP +S DVK+ +N Sbjct: 420 NYVTYWTLIQGYVRCGNMIEISKIYDKMHIHGLLPTNVSG---------DVKQSCPAIHN 470 Query: 262 MSEAIC 245 + C Sbjct: 471 PNRETC 476 >ONM59772.1 Putative pentatricopeptide repeat-containing protein [Zea mays] ONM59776.1 Putative pentatricopeptide repeat-containing protein [Zea mays] ONM59777.1 Putative pentatricopeptide repeat-containing protein [Zea mays] ONM59782.1 Putative pentatricopeptide repeat-containing protein [Zea mays] ONM59784.1 Putative pentatricopeptide repeat-containing protein [Zea mays] ONM59786.1 Putative pentatricopeptide repeat-containing protein [Zea mays] ONM59788.1 Putative pentatricopeptide repeat-containing protein [Zea mays] Length = 765 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/66 (42%), Positives = 41/66 (62%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPAIMSDRKMGQVKPIDVKEHTRDTYN 263 N+VT+ TL+QGY+RCG+ +ISK+YD+MH+ GLLP +S DVK+ +N Sbjct: 701 NYVTYWTLIQGYVRCGNMIEISKIYDKMHIHGLLPTNVSG---------DVKQSCPAIHN 751 Query: 262 MSEAIC 245 + C Sbjct: 752 PNRETC 757 >ONM59775.1 Putative pentatricopeptide repeat-containing protein [Zea mays] ONM59778.1 Putative pentatricopeptide repeat-containing protein [Zea mays] ONM59780.1 Putative pentatricopeptide repeat-containing protein [Zea mays] ONM59781.1 Putative pentatricopeptide repeat-containing protein [Zea mays] ONM59783.1 Putative pentatricopeptide repeat-containing protein [Zea mays] ONM59789.1 Putative pentatricopeptide repeat-containing protein [Zea mays] ONM59790.1 Putative pentatricopeptide repeat-containing protein [Zea mays] Length = 939 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/66 (42%), Positives = 41/66 (62%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLPAIMSDRKMGQVKPIDVKEHTRDTYN 263 N+VT+ TL+QGY+RCG+ +ISK+YD+MH+ GLLP +S DVK+ +N Sbjct: 875 NYVTYWTLIQGYVRCGNMIEISKIYDKMHIHGLLPTNVSG---------DVKQSCPAIHN 925 Query: 262 MSEAIC 245 + C Sbjct: 926 PNRETC 931 >XP_018685303.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Musa acuminata subsp. malaccensis] XP_018685304.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Musa acuminata subsp. malaccensis] XP_018685305.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Musa acuminata subsp. malaccensis] Length = 966 Score = 58.5 bits (140), Expect = 3e-07 Identities = 23/35 (65%), Positives = 33/35 (94%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLP 338 ++VT+STL+ GYI+ G+TQQ++KLY+EMH+RGLLP Sbjct: 900 DYVTYSTLIHGYIKRGETQQVTKLYEEMHIRGLLP 934 >BAH93045.1 Os05g0275100, partial [Oryza sativa Japonica Group] Length = 213 Score = 57.0 bits (136), Expect = 5e-07 Identities = 22/35 (62%), Positives = 31/35 (88%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLP 338 N++T+ TL+ GYI+ G+ ++ISKLYDEMH+RGLLP Sbjct: 148 NYITYCTLIHGYIKSGNMEEISKLYDEMHIRGLLP 182 >AAT85126.1 hypothetical protein [Oryza sativa Japonica Group] Length = 920 Score = 57.0 bits (136), Expect = 1e-06 Identities = 22/35 (62%), Positives = 31/35 (88%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLP 338 N++T+ TL+ GYI+ G+ ++ISKLYDEMH+RGLLP Sbjct: 855 NYITYCTLIHGYIKSGNMEEISKLYDEMHIRGLLP 889 >EEC78894.1 hypothetical protein OsI_19266 [Oryza sativa Indica Group] EEE63070.1 hypothetical protein OsJ_17878 [Oryza sativa Japonica Group] BAS93110.1 Os05g0275100 [Oryza sativa Japonica Group] Length = 939 Score = 57.0 bits (136), Expect = 1e-06 Identities = 22/35 (62%), Positives = 31/35 (88%) Frame = -1 Query: 442 NFVTFSTLVQGYIRCGDTQQISKLYDEMHVRGLLP 338 N++T+ TL+ GYI+ G+ ++ISKLYDEMH+RGLLP Sbjct: 874 NYITYCTLIHGYIKSGNMEEISKLYDEMHIRGLLP 908