BLASTX nr result
ID: Magnolia22_contig00035692
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00035692 (479 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009045728.1 orf112a (mitochondrion) [Batis maritima] AIC83331... 62 2e-09 YP_173473.1 hypothetical protein NitaMp136 [Nicotiana tabacum] B... 59 3e-08 CBI33208.3 unnamed protein product, partial [Vitis vinifera] 54 4e-06 >YP_009045728.1 orf112a (mitochondrion) [Batis maritima] AIC83331.1 orf112a (mitochondrion) [Batis maritima] Length = 112 Score = 61.6 bits (148), Expect = 2e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 127 HLRVTVGTSISPYRGSTCYKRRTSPFQNIHIGP 29 + RV V TSISPYRGSTCYKRR +PFQNIHIGP Sbjct: 5 YFRVRVRTSISPYRGSTCYKRRAAPFQNIHIGP 37 >YP_173473.1 hypothetical protein NitaMp136 [Nicotiana tabacum] BAD83539.1 hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 137 Score = 59.3 bits (142), Expect = 3e-08 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -2 Query: 127 HLRVTVGTSISPYRGSTCYKRRTSPFQNIHIGPPAASKRGRK 2 +L + V T ISPYRGS CYKRRTSPFQNI+IGP A ++G K Sbjct: 5 YLCLRVRTYISPYRGSICYKRRTSPFQNINIGPQADIEKGAK 46 >CBI33208.3 unnamed protein product, partial [Vitis vinifera] Length = 142 Score = 53.5 bits (127), Expect = 4e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -2 Query: 94 PYRGSTCYKRRTSPFQNIHIGP 29 PYRGSTCYKRRTSPFQNIHIGP Sbjct: 7 PYRGSTCYKRRTSPFQNIHIGP 28