BLASTX nr result
ID: Magnolia22_contig00035653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00035653 (354 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018249717.1 hypothetical protein FOXG_20544 [Fusarium oxyspor... 51 1e-06 EFW13470.1 hypothetical protein CPSG_09922 [Coccidioides posadas... 53 2e-06 KFH43929.1 hypothetical protein ACRE_053060 [Acremonium chrysoge... 51 2e-06 EQB53989.1 hypothetical protein CGLO_06227 [Colletotrichum gloeo... 53 4e-06 XP_001806136.1 hypothetical protein SNOG_16005 [Parastagonospora... 50 5e-06 XP_009226536.1 hypothetical protein GGTG_10399 [Gaeumannomyces t... 52 7e-06 >XP_018249717.1 hypothetical protein FOXG_20544 [Fusarium oxysporum f. sp. lycopersici 4287] XP_018757512.1 hypothetical protein FVEG_16784 [Fusarium verticillioides 7600] EWG51321.1 hypothetical protein FVEG_16784 [Fusarium verticillioides 7600] EWY85261.1 hypothetical protein FOYG_12499 [Fusarium oxysporum FOSC 3-a] EWZ35712.1 hypothetical protein FOZG_11578 [Fusarium oxysporum Fo47] EWZ96292.1 hypothetical protein FOWG_03707 [Fusarium oxysporum f. sp. lycopersici MN25] EXA37840.1 hypothetical protein FOVG_11928 [Fusarium oxysporum f. sp. pisi HDV247] EXK30141.1 hypothetical protein FOMG_13780 [Fusarium oxysporum f. sp. melonis 26406] EXK90269.1 hypothetical protein FOQG_07096 [Fusarium oxysporum f. sp. raphani 54005] EXL55250.1 hypothetical protein FOCG_05914 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] EXL81768.1 hypothetical protein FOPG_05108 [Fusarium oxysporum f. sp. conglutinans race 2 54008] EXM05656.1 hypothetical protein FOIG_04172 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] EXM27212.1 hypothetical protein FOTG_06566 [Fusarium oxysporum f. sp. vasinfectum 25433] KNB11672.1 hypothetical protein FOXG_20544 [Fusarium oxysporum f. sp. lycopersici 4287] Length = 42 Score = 51.2 bits (121), Expect = 1e-06 Identities = 23/41 (56%), Positives = 26/41 (63%) Frame = +3 Query: 45 MPFLWTKNFXXXXXXXXVTVDRHGVRRNPFRFSLGKFSCFR 167 M W+K V VD+HGVRR P+RFSLGKFSCFR Sbjct: 1 MGLFWSKGVGGRHFGTSVHVDKHGVRRGPWRFSLGKFSCFR 41 >EFW13470.1 hypothetical protein CPSG_09922 [Coccidioides posadasii str. Silveira] Length = 115 Score = 52.8 bits (125), Expect = 2e-06 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 3/56 (5%) Frame = +3 Query: 9 KQNKTKHKKRD---KMPFLWTKNFXXXXXXXXVTVDRHGVRRNPFRFSLGKFSCFR 167 K ++T+ KK++ KMPF ++K F +TV RHGVRR P+ F LGK CFR Sbjct: 60 KLSQTRWKKKNINQKMPFFYSKRFGGRHISTGITVSRHGVRRQPWGFRLGKCLCFR 115 >KFH43929.1 hypothetical protein ACRE_053060 [Acremonium chrysogenum ATCC 11550] Length = 43 Score = 50.8 bits (120), Expect = 2e-06 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = +3 Query: 45 MPFLWTKNFXXXXXXXXVTVDRHGVRRNPFRFSLGKFSCFR 167 M W K V VDRHGVRR P+RFSLGK+SCFR Sbjct: 1 MGLFWGKGIGTRHFGTSVRVDRHGVRRGPWRFSLGKYSCFR 41 >EQB53989.1 hypothetical protein CGLO_06227 [Colletotrichum gloeosporioides Cg-14] Length = 190 Score = 53.1 bits (126), Expect = 4e-06 Identities = 23/52 (44%), Positives = 33/52 (63%) Frame = +3 Query: 12 QNKTKHKKRDKMPFLWTKNFXXXXXXXXVTVDRHGVRRNPFRFSLGKFSCFR 167 +NKT H++ MPF ++K V DRHG+RR P+RF +G+F+CFR Sbjct: 140 KNKT-HQRTSNMPFFYSKPIGGKNFGTSVHADRHGIRRGPWRFRIGRFNCFR 190 >XP_001806136.1 hypothetical protein SNOG_16005 [Parastagonospora nodorum SN15] EAT76584.1 hypothetical protein SNOG_16005 [Parastagonospora nodorum SN15] Length = 41 Score = 49.7 bits (117), Expect = 5e-06 Identities = 22/41 (53%), Positives = 24/41 (58%) Frame = +3 Query: 45 MPFLWTKNFXXXXXXXXVTVDRHGVRRNPFRFSLGKFSCFR 167 M +W K F V DRHGVRR PFR S G+FSCFR Sbjct: 1 MGLMWHKGFGGRHAGGGVVADRHGVRRAPFRLSCGRFSCFR 41 >XP_009226536.1 hypothetical protein GGTG_10399 [Gaeumannomyces tritici R3-111a-1] EJT71139.1 hypothetical protein GGTG_10399 [Gaeumannomyces tritici R3-111a-1] Length = 151 Score = 52.0 bits (123), Expect = 7e-06 Identities = 22/42 (52%), Positives = 29/42 (69%) Frame = +3 Query: 42 KMPFLWTKNFXXXXXXXXVTVDRHGVRRNPFRFSLGKFSCFR 167 +MPF ++K F V DRHGVRR P+RFSLG+F+CF+ Sbjct: 107 EMPFFYSKAFGGRHFGTSVHADRHGVRRGPWRFSLGRFNCFK 148