BLASTX nr result
ID: Magnolia22_contig00035633
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00035633 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018001632.1 hypothetical protein AB675_9045 [Phialophora atta... 90 1e-18 >XP_018001632.1 hypothetical protein AB675_9045 [Phialophora attae] KPI41669.1 hypothetical protein AB675_9045 [Phialophora attae] Length = 956 Score = 90.1 bits (222), Expect = 1e-18 Identities = 34/83 (40%), Positives = 54/83 (65%) Frame = -3 Query: 359 ASTGALTVKFSDNSAFSLAQNTWHTDLILAFYDGTCGTALNCYAVCKQLSFNSDSRTCTM 180 A++ L + F + SAF +A WH+ +I FYDG+CG ALNCY + + +F+ S+ C++ Sbjct: 182 AASENLAITFKNPSAFQIAHTMWHSGMIFTFYDGSCGPALNCYIIAQDFAFDESSQKCSV 241 Query: 179 STSKTAFEDIASYFTFQWGNYQP 111 +T F+++ F FQWGNY+P Sbjct: 242 TTKSANFDEVCENFEFQWGNYKP 264