BLASTX nr result
ID: Magnolia22_contig00035601
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00035601 (363 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007679955.1 hypothetical protein BAUCODRAFT_77254, partial [B... 72 3e-13 KXS94152.1 hypothetical protein AC578_11142 [Mycosphaerella eumu... 74 8e-13 XP_007932094.1 hypothetical protein MYCFIDRAFT_146670 [Pseudocer... 71 1e-12 EME41695.1 hypothetical protein DOTSEDRAFT_103119, partial [Doth... 69 4e-12 KXT12649.1 hypothetical protein AC579_4494 [Pseudocercospora musae] 68 6e-11 KXL42819.1 hypothetical protein FE78DRAFT_82350 [Acidomyces rich... 64 5e-10 KJX97366.1 hypothetical protein TI39_contig502g00005 [Zymoseptor... 56 9e-07 >XP_007679955.1 hypothetical protein BAUCODRAFT_77254, partial [Baudoinia panamericana UAMH 10762] EMC92734.1 hypothetical protein BAUCODRAFT_77254, partial [Baudoinia panamericana UAMH 10762] Length = 199 Score = 72.4 bits (176), Expect = 3e-13 Identities = 39/91 (42%), Positives = 54/91 (59%) Frame = -1 Query: 273 FAPGDATIQYHGRDGHLCHISNINLLIVEATSALLPHAFQETRSGPCFYSELLSPVTAPA 94 + G AT+ + G DG +I IN +E LL AF++ RSG + E L+ TA Sbjct: 4 YPSGSATVSFPGNDGETHYIHKINTWFIEKRCPLLAMAFEDVRSGSQLHLEALTGTTAYP 63 Query: 93 FVRFLYTGTYAPSKPDGVGNLYDDVPTSLLL 1 F+RFLYTG+YA + G+ ++DVPTSLLL Sbjct: 64 FLRFLYTGSYALTTAS--GDCFEDVPTSLLL 92 >KXS94152.1 hypothetical protein AC578_11142 [Mycosphaerella eumusae] Length = 522 Score = 73.6 bits (179), Expect = 8e-13 Identities = 42/97 (43%), Positives = 60/97 (61%) Frame = -1 Query: 291 LDFLRDFAPGDATIQYHGRDGHLCHISNINLLIVEATSALLPHAFQETRSGPCFYSELLS 112 + FL F G+ATI Y G + IS++N I+E S LL AF+E+ +GP + E L+ Sbjct: 112 MSFLAWFPKGNATITYLNDLGDMESISDLNPWIIEERSLLLAQAFEESNTGPQLHLEPLT 171 Query: 111 PVTAPAFVRFLYTGTYAPSKPDGVGNLYDDVPTSLLL 1 P++A F+++LYTG Y S P G + DVPTSLL+ Sbjct: 172 PLSARPFLQYLYTGAY--SLPTANGEPFRDVPTSLLV 206 >XP_007932094.1 hypothetical protein MYCFIDRAFT_146670 [Pseudocercospora fijiensis CIRAD86] EME77330.1 hypothetical protein MYCFIDRAFT_146670 [Pseudocercospora fijiensis CIRAD86] Length = 205 Score = 70.9 bits (172), Expect = 1e-12 Identities = 39/97 (40%), Positives = 60/97 (61%) Frame = -1 Query: 291 LDFLRDFAPGDATIQYHGRDGHLCHISNINLLIVEATSALLPHAFQETRSGPCFYSELLS 112 + FL F G+ATI Y G + IS+++ I+E S LL AF+++ +GP + E L+ Sbjct: 1 MSFLHCFPKGNATITYLNDLGDMESISDLSPCIIEERSFLLAQAFEDSTTGPQLHLEPLT 60 Query: 111 PVTAPAFVRFLYTGTYAPSKPDGVGNLYDDVPTSLLL 1 P++A F+++LYTG Y + P G + DVPTSLL+ Sbjct: 61 PLSARPFLQYLYTGVY--NLPTANGESFQDVPTSLLV 95 >EME41695.1 hypothetical protein DOTSEDRAFT_103119, partial [Dothistroma septosporum NZE10] Length = 200 Score = 69.3 bits (168), Expect = 4e-12 Identities = 39/97 (40%), Positives = 53/97 (54%) Frame = -1 Query: 291 LDFLRDFAPGDATIQYHGRDGHLCHISNINLLIVEATSALLPHAFQETRSGPCFYSELLS 112 + FL + GDATI Y I ++ ++E S L+ AF+ +R G + + L Sbjct: 1 MSFLEWYPKGDATITYPDDSEWSQAICGLHTWVIEERSPLIAQAFERSREGQQLHLDCLD 60 Query: 111 PVTAPAFVRFLYTGTYAPSKPDGVGNLYDDVPTSLLL 1 P TA VR+LYTG+YA GN Y+DVPTSLLL Sbjct: 61 PTTALPLVRYLYTGSYA-----AAGNQYEDVPTSLLL 92 >KXT12649.1 hypothetical protein AC579_4494 [Pseudocercospora musae] Length = 460 Score = 68.2 bits (165), Expect = 6e-11 Identities = 39/98 (39%), Positives = 61/98 (62%) Frame = -1 Query: 294 NLDFLRDFAPGDATIQYHGRDGHLCHISNINLLIVEATSALLPHAFQETRSGPCFYSELL 115 ++ FL F G+ATI Y G + IS+++ I+EA S LL AF+++ +GP + E L Sbjct: 90 DMSFLDCFPKGNATITYLNDLGDMESISHLSPWIIEARSLLLAQAFEQSNTGPQLHLEPL 149 Query: 114 SPVTAPAFVRFLYTGTYAPSKPDGVGNLYDDVPTSLLL 1 +P++A F+++LYTG Y + P G + VPTSLL+ Sbjct: 150 TPLSARPFLQYLYTGAY--TLPTVDGESFQVVPTSLLV 185 >KXL42819.1 hypothetical protein FE78DRAFT_82350 [Acidomyces richmondensis] KYG43651.1 hypothetical protein M433DRAFT_145646 [Acidomyces richmondensis BFW] Length = 202 Score = 63.9 bits (154), Expect = 5e-10 Identities = 37/83 (44%), Positives = 50/83 (60%) Frame = -1 Query: 252 IQYHGRDGHLCHISNINLLIVEATSALLPHAFQETRSGPCFYSELLSPVTAPAFVRFLYT 73 I Y G G + + NIN + EA S LL AF+ +RSGP + E L+ TA F+RFLYT Sbjct: 2 ISYPGDHGEIETVQNINRWVFEARSPLLAAAFESSRSGPQLHLEALTSDTAIPFLRFLYT 61 Query: 72 GTYAPSKPDGVGNLYDDVPTSLL 4 G+YA V + + +VPTS+L Sbjct: 62 GSYA------VEDTFAEVPTSVL 78 >KJX97366.1 hypothetical protein TI39_contig502g00005 [Zymoseptoria brevis] Length = 604 Score = 56.2 bits (134), Expect = 9e-07 Identities = 44/121 (36%), Positives = 66/121 (54%), Gaps = 1/121 (0%) Frame = -1 Query: 360 HAIDLPNPKAFPIATSPGEVAENLDFLRDFAPGDATIQYHGRDGH-LCHISNINLLIVEA 184 H I+ P+ ++ SP V +N PG TI Y GH + + I L +E Sbjct: 19 HEIEPPDFRS----NSPTPVTKN--------PG--TITYPSTCGHGVESVPGIALHRIED 64 Query: 183 TSALLPHAFQETRSGPCFYSELLSPVTAPAFVRFLYTGTYAPSKPDGVGNLYDDVPTSLL 4 + LL AF+ TR+GP + E L+ +TA FVRFL G+Y+ ++ G++Y DVP+S+L Sbjct: 65 SCPLLAAAFETTRAGPRLHLETLNFITARPFVRFLQCGSYSITEH---GDIYADVPSSIL 121 Query: 3 L 1 L Sbjct: 122 L 122