BLASTX nr result
ID: Magnolia22_contig00034111
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00034111 (317 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAL02597.1 ribosomal protein L35Ae [Stagonospora sp. SRC1lsM3a] 105 2e-27 OAL51055.1 ribosomal protein L35Ae [Pyrenochaeta sp. DS3sAY3a] 103 8e-27 KZM20125.1 structural constituent of ribosome [Ascochyta rabiei] 103 1e-26 XP_001799711.1 hypothetical protein SNOG_09417 [Parastagonospora... 102 3e-26 XP_018036066.1 ribosomal protein L35Ae [Paraphaeosphaeria sporul... 101 7e-26 XP_018385215.1 ribosomal protein L35Ae [Alternaria alternata] OA... 101 7e-26 XP_003844504.1 hypothetical protein LEMA_P021550.1 [Leptosphaeri... 102 2e-25 XP_001931342.1 60S ribosomal protein L33 [Pyrenophora tritici-re... 100 3e-25 KMU89836.1 60S ribosomal protein L33-A [Coccidioides immitis H53... 100 3e-25 KMM69572.1 60S ribosomal protein L33-A [Coccidioides posadasii R... 100 4e-25 XP_003068012.1 60S ribosomal protein L33 [Coccidioides posadasii... 100 4e-25 XP_001240474.2 60S ribosomal protein L33-A [Coccidioides immitis... 100 4e-25 XP_002582873.1 60S ribosomal protein L33-A [Uncinocarpus reesii ... 99 8e-25 XP_002847241.1 60S ribosomal protein L33 [Arthroderma otae CBS 1... 97 6e-24 OMP89224.1 60S ribosomal protein L33-B [Diplodia seriata] 96 6e-24 EZF20544.1 60S ribosomal protein L33-A [Trichophyton rubrum MR85... 97 7e-24 EGE03723.1 60S ribosomal protein L35a [Trichophyton equinum CBS ... 97 7e-24 EGD99236.1 60S ribosomal protein L35a [Trichophyton tonsurans CB... 97 7e-24 XP_003169734.1 ribosomal L15 [Nannizzia gypsea CBS 118893] EFR04... 97 7e-24 XP_016632934.1 60S ribosomal protein L33-A [Fonsecaea multimorph... 96 9e-24 >OAL02597.1 ribosomal protein L35Ae [Stagonospora sp. SRC1lsM3a] Length = 108 Score = 105 bits (262), Expect = 2e-27 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI Sbjct: 58 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 108 >OAL51055.1 ribosomal protein L35Ae [Pyrenochaeta sp. DS3sAY3a] Length = 108 Score = 103 bits (258), Expect = 8e-27 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPK+FGASVRVMLYPSSI Sbjct: 58 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKSFGASVRVMLYPSSI 108 >KZM20125.1 structural constituent of ribosome [Ascochyta rabiei] Length = 115 Score = 103 bits (258), Expect = 1e-26 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPK+FGASVRVMLYPSSI Sbjct: 65 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKSFGASVRVMLYPSSI 115 >XP_001799711.1 hypothetical protein SNOG_09417 [Parastagonospora nodorum SN15] EAT83609.1 hypothetical protein SNOG_09417 [Parastagonospora nodorum SN15] Length = 108 Score = 102 bits (254), Expect = 3e-26 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 RAIQGSKIRVIWGKVTRPHGNSG VRAKFRSNLPPK+FGASVRVMLYPSSI Sbjct: 58 RAIQGSKIRVIWGKVTRPHGNSGAVRAKFRSNLPPKSFGASVRVMLYPSSI 108 >XP_018036066.1 ribosomal protein L35Ae [Paraphaeosphaeria sporulosa] OAG05701.1 ribosomal protein L35Ae [Paraphaeosphaeria sporulosa] Length = 108 Score = 101 bits (252), Expect = 7e-26 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 R ++GSKIRVIWGK+TRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI Sbjct: 58 RTVRGSKIRVIWGKITRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 108 >XP_018385215.1 ribosomal protein L35Ae [Alternaria alternata] OAG19794.1 ribosomal protein L35Ae [Alternaria alternata] Length = 110 Score = 101 bits (252), Expect = 7e-26 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 RAIQGSKIRVIWGKVTRPHGNSGVVRAKF++NLPPK+FGASVRVMLYPSSI Sbjct: 60 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFKNNLPPKSFGASVRVMLYPSSI 110 >XP_003844504.1 hypothetical protein LEMA_P021550.1 [Leptosphaeria maculans JN3] CBY01025.1 hypothetical protein LEMA_P021550.1 [Leptosphaeria maculans JN3] Length = 186 Score = 102 bits (255), Expect = 2e-25 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 +AIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPK+FGASVRVMLYPSSI Sbjct: 136 KAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKSFGASVRVMLYPSSI 186 >XP_001931342.1 60S ribosomal protein L33 [Pyrenophora tritici-repentis Pt-1C-BFP] XP_003306337.1 60S ribosomal protein L33 [Pyrenophora teres f. teres 0-1] EDU40447.1 60S ribosomal protein L33 [Pyrenophora tritici-repentis Pt-1C-BFP] EFQ85570.1 hypothetical protein PTT_19467 [Pyrenophora teres f. teres 0-1] Length = 109 Score = 100 bits (248), Expect = 3e-25 Identities = 46/51 (90%), Positives = 51/51 (100%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 +AIQGSKIRVIWGK+TRPHGNSGVVRAKF++NLPPK+FGASVRVMLYPSSI Sbjct: 59 KAIQGSKIRVIWGKITRPHGNSGVVRAKFKNNLPPKSFGASVRVMLYPSSI 109 >KMU89836.1 60S ribosomal protein L33-A [Coccidioides immitis H538.4] Length = 98 Score = 99.8 bits (247), Expect = 3e-25 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 R +QGSKIRVIWGKVTRPHGNSGVVRA+FR NLPPKTFGASVRVMLYPSSI Sbjct: 48 REVQGSKIRVIWGKVTRPHGNSGVVRAQFRHNLPPKTFGASVRVMLYPSSI 98 >KMM69572.1 60S ribosomal protein L33-A [Coccidioides posadasii RMSCC 3488] KMP06010.1 60S ribosomal protein L35a [Coccidioides immitis RMSCC 2394] KMU76558.1 60S ribosomal protein L35a [Coccidioides immitis RMSCC 3703] Length = 104 Score = 99.8 bits (247), Expect = 4e-25 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 R +QGSKIRVIWGKVTRPHGNSGVVRA+FR NLPPKTFGASVRVMLYPSSI Sbjct: 54 REVQGSKIRVIWGKVTRPHGNSGVVRAQFRHNLPPKTFGASVRVMLYPSSI 104 >XP_003068012.1 60S ribosomal protein L33 [Coccidioides posadasii C735 delta SOWgp] EER25867.1 60S ribosomal protein L33-B, putative [Coccidioides posadasii C735 delta SOWgp] Length = 107 Score = 99.8 bits (247), Expect = 4e-25 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 R +QGSKIRVIWGKVTRPHGNSGVVRA+FR NLPPKTFGASVRVMLYPSSI Sbjct: 57 REVQGSKIRVIWGKVTRPHGNSGVVRAQFRHNLPPKTFGASVRVMLYPSSI 107 >XP_001240474.2 60S ribosomal protein L33-A [Coccidioides immitis RS] EFW14318.1 60S ribosomal protein L33 [Coccidioides posadasii str. Silveira] EAS28891.3 60S ribosomal protein L33-A [Coccidioides immitis RS] Length = 109 Score = 99.8 bits (247), Expect = 4e-25 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 R +QGSKIRVIWGKVTRPHGNSGVVRA+FR NLPPKTFGASVRVMLYPSSI Sbjct: 59 REVQGSKIRVIWGKVTRPHGNSGVVRAQFRHNLPPKTFGASVRVMLYPSSI 109 >XP_002582873.1 60S ribosomal protein L33-A [Uncinocarpus reesii 1704] EEP82781.1 60S ribosomal protein L33-A [Uncinocarpus reesii 1704] Length = 109 Score = 99.0 bits (245), Expect = 8e-25 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 R +QGSKIRVIWGKVTRPHGNSGVVRA+FR+NLPPK+FGASVRVMLYPSSI Sbjct: 59 REVQGSKIRVIWGKVTRPHGNSGVVRAQFRNNLPPKSFGASVRVMLYPSSI 109 >XP_002847241.1 60S ribosomal protein L33 [Arthroderma otae CBS 113480] EEQ32159.1 60S ribosomal protein L33 [Arthroderma otae CBS 113480] Length = 105 Score = 96.7 bits (239), Expect = 6e-24 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 R ++GSKIRVIWGKVTRPHGNSGVVRA+FR NLPPK+FGASVRVMLYPSSI Sbjct: 55 REVRGSKIRVIWGKVTRPHGNSGVVRAQFRHNLPPKSFGASVRVMLYPSSI 105 >OMP89224.1 60S ribosomal protein L33-B [Diplodia seriata] Length = 83 Score = 95.9 bits (237), Expect = 6e-24 Identities = 43/51 (84%), Positives = 50/51 (98%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 + ++GSKIRVIWGKVTRPHGNSGVVRA+FR+NLPPK+FGASVR+MLYPSSI Sbjct: 33 KEVRGSKIRVIWGKVTRPHGNSGVVRAQFRNNLPPKSFGASVRIMLYPSSI 83 >EZF20544.1 60S ribosomal protein L33-A [Trichophyton rubrum MR850] EZF40848.1 60S ribosomal protein L33-A [Trichophyton rubrum CBS 100081] EZF51756.1 60S ribosomal protein L33-A [Trichophyton rubrum CBS 288.86] EZF62164.1 60S ribosomal protein L33-A [Trichophyton rubrum CBS 289.86] EZF73002.1 60S ribosomal protein L33-A [Trichophyton soudanense CBS 452.61] EZF83412.1 60S ribosomal protein L33-A [Trichophyton rubrum MR1448] EZF94366.1 60S ribosomal protein L33-A [Trichophyton rubrum MR1459] EZG05343.1 60S ribosomal protein L33-A [Trichophyton rubrum CBS 735.88] EZG15641.1 60S ribosomal protein L33-A [Trichophyton rubrum CBS 202.88] KDB32599.1 60S ribosomal protein L33-A [Trichophyton rubrum D6] KMQ45836.1 Ribosomal protein L35A [Trichophyton rubrum] Length = 109 Score = 96.7 bits (239), Expect = 7e-24 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 R ++GSKIRVIWGKVTRPHGNSGVVRA+FR NLPPK+FGASVRVMLYPSSI Sbjct: 59 REVRGSKIRVIWGKVTRPHGNSGVVRAQFRHNLPPKSFGASVRVMLYPSSI 109 >EGE03723.1 60S ribosomal protein L35a [Trichophyton equinum CBS 127.97] EZF34635.1 60S ribosomal protein L33-A [Trichophyton interdigitale H6] KDB21549.1 60S ribosomal protein L33-A [Trichophyton interdigitale MR816] DAA79181.1 TPA_exp: hypothetical protein A8136_2966 [Trichophyton benhamiae CBS 112371] Length = 109 Score = 96.7 bits (239), Expect = 7e-24 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 R ++GSKIRVIWGKVTRPHGNSGVVRA+FR NLPPK+FGASVRVMLYPSSI Sbjct: 59 REVRGSKIRVIWGKVTRPHGNSGVVRAQFRHNLPPKSFGASVRVMLYPSSI 109 >EGD99236.1 60S ribosomal protein L35a [Trichophyton tonsurans CBS 112818] Length = 110 Score = 96.7 bits (239), Expect = 7e-24 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 R ++GSKIRVIWGKVTRPHGNSGVVRA+FR NLPPK+FGASVRVMLYPSSI Sbjct: 60 REVRGSKIRVIWGKVTRPHGNSGVVRAQFRHNLPPKSFGASVRVMLYPSSI 110 >XP_003169734.1 ribosomal L15 [Nannizzia gypsea CBS 118893] EFR04899.1 ribosomal L15 [Nannizzia gypsea CBS 118893] Length = 112 Score = 96.7 bits (239), Expect = 7e-24 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +3 Query: 3 RAIQGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 R ++GSKIRVIWGKVTRPHGNSGVVRA+FR NLPPK+FGASVRVMLYPSSI Sbjct: 62 REVRGSKIRVIWGKVTRPHGNSGVVRAQFRHNLPPKSFGASVRVMLYPSSI 112 >XP_016632934.1 60S ribosomal protein L33-A [Fonsecaea multimorphosa CBS 102226] XP_018696974.1 60S ribosomal protein L33-A [Fonsecaea erecta] KIX98811.1 60S ribosomal protein L33-A [Fonsecaea multimorphosa CBS 102226] OAL25092.1 60S ribosomal protein L33-A [Fonsecaea multimorphosa] OAP63607.1 60S ribosomal protein L33-A [Fonsecaea erecta] Length = 109 Score = 96.3 bits (238), Expect = 9e-24 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +3 Query: 12 QGSKIRVIWGKVTRPHGNSGVVRAKFRSNLPPKTFGASVRVMLYPSSI 155 QGSKIRVIWGKVTRPHGNSG+VRAKFR NLPPK+FGASVR+MLYPSSI Sbjct: 62 QGSKIRVIWGKVTRPHGNSGIVRAKFRHNLPPKSFGASVRIMLYPSSI 109