BLASTX nr result
ID: Magnolia22_contig00034025
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00034025 (516 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018693162.1 hypothetical protein AYL99_04797 [Fonsecaea erect... 61 7e-08 XP_016627631.1 hypothetical protein Z520_10686 [Fonsecaea multim... 61 7e-08 XP_016253261.1 hypothetical protein PV07_04546 [Cladophialophora... 61 7e-08 KIW66483.1 hypothetical protein PV04_05816 [Capronia semi-immersa] 60 1e-07 XP_016613584.1 hypothetical protein Z519_12537 [Cladophialophora... 60 1e-07 XP_007751578.1 beta-keto reductase [Cladophialophora psammophila... 60 1e-07 XP_013269315.1 hypothetical protein Z518_08118 [Rhinocladiella m... 60 2e-07 OAL26123.1 hypothetical protein AYO20_10257 [Fonsecaea nubica] 59 4e-07 XP_013284723.1 hypothetical protein Z517_03938 [Fonsecaea pedros... 59 4e-07 OAG39449.1 hypothetical protein AYO21_06277 [Fonsecaea monophora] 59 4e-07 XP_007722434.1 beta-keto reductase [Capronia coronata CBS 617.96... 58 9e-07 XP_007735248.1 beta-keto reductase [Capronia epimyces CBS 606.96... 58 9e-07 XP_016268708.1 hypothetical protein PV06_01071 [Exophiala oligos... 57 2e-06 KIV84479.1 hypothetical protein PV11_00254 [Exophiala sideris] 57 2e-06 XP_013316125.1 hypothetical protein PV05_04272 [Exophiala xenobi... 55 8e-06 XP_016240004.1 hypothetical protein PV08_00363 [Exophiala spinif... 55 8e-06 >XP_018693162.1 hypothetical protein AYL99_04797 [Fonsecaea erecta] OAP59795.1 hypothetical protein AYL99_04797 [Fonsecaea erecta] Length = 338 Score = 60.8 bits (146), Expect = 7e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 GSPYWSHA+V IT +LGPMN +LLGIN+KMHVDI Sbjct: 284 GSPYWSHALVAALITGVLGPMNSILLGINKKMHVDI 319 >XP_016627631.1 hypothetical protein Z520_10686 [Fonsecaea multimorphosa CBS 102226] KIX93508.1 hypothetical protein Z520_10686 [Fonsecaea multimorphosa CBS 102226] OAL18824.1 hypothetical protein AYO22_10153 [Fonsecaea multimorphosa] Length = 338 Score = 60.8 bits (146), Expect = 7e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 GSPYWSHA+V IT +LGPMN +LLGIN+KMHVDI Sbjct: 284 GSPYWSHALVAALITGVLGPMNSILLGINKKMHVDI 319 >XP_016253261.1 hypothetical protein PV07_04546 [Cladophialophora immunda] KIW33045.1 hypothetical protein PV07_04546 [Cladophialophora immunda] Length = 338 Score = 60.8 bits (146), Expect = 7e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 GSPYWSHA+V IT +LGPMN +LLGIN+KMHVDI Sbjct: 284 GSPYWSHALVAALITGVLGPMNSILLGINKKMHVDI 319 >KIW66483.1 hypothetical protein PV04_05816 [Capronia semi-immersa] Length = 337 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 GSPYWSHA+V IT +LGPMN +LLGINR MHVDI Sbjct: 286 GSPYWSHALVAALITGVLGPMNSILLGINRSMHVDI 321 >XP_016613584.1 hypothetical protein Z519_12537 [Cladophialophora bantiana CBS 173.52] KIW86915.1 hypothetical protein Z519_12537 [Cladophialophora bantiana CBS 173.52] Length = 338 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 GSPYWSHA+V IT +LGPMN +LLG+N+KMHVDI Sbjct: 284 GSPYWSHALVAALITGVLGPMNNILLGVNKKMHVDI 319 >XP_007751578.1 beta-keto reductase [Cladophialophora psammophila CBS 110553] EXJ54908.1 beta-keto reductase [Cladophialophora psammophila CBS 110553] Length = 338 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 GSPYWSHA+V IT +LGPMN +LLG+N+KMHVDI Sbjct: 284 GSPYWSHALVAALITGVLGPMNNILLGVNKKMHVDI 319 >XP_013269315.1 hypothetical protein Z518_08118 [Rhinocladiella mackenziei CBS 650.93] KIX02179.1 hypothetical protein Z518_08118 [Rhinocladiella mackenziei CBS 650.93] Length = 295 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 GSPYWSHA+V IT +LGPM+ +LLGIN+KMHVDI Sbjct: 241 GSPYWSHALVAAFITGVLGPMSTILLGINKKMHVDI 276 >OAL26123.1 hypothetical protein AYO20_10257 [Fonsecaea nubica] Length = 338 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 G+PYWSHA+V IT +LGPM+ +LLGINRKMHVDI Sbjct: 284 GTPYWSHALVAALITGVLGPMSSILLGINRKMHVDI 319 >XP_013284723.1 hypothetical protein Z517_03938 [Fonsecaea pedrosoi CBS 271.37] KIW80915.1 hypothetical protein Z517_03938 [Fonsecaea pedrosoi CBS 271.37] Length = 338 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 G+PYWSHA+V IT +LGPM+ +LLGINRKMHVDI Sbjct: 284 GTPYWSHALVAALITGVLGPMSSILLGINRKMHVDI 319 >OAG39449.1 hypothetical protein AYO21_06277 [Fonsecaea monophora] Length = 356 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 G+PYWSHA+V IT +LGPM+ +LLGINRKMHVDI Sbjct: 302 GTPYWSHALVAALITGVLGPMSSILLGINRKMHVDI 337 >XP_007722434.1 beta-keto reductase [Capronia coronata CBS 617.96] EXJ90240.1 beta-keto reductase [Capronia coronata CBS 617.96] Length = 336 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 GSPYWSHA++ IT +LGPMN +LLGIN+ MHVDI Sbjct: 282 GSPYWSHALLAALITGVLGPMNSILLGINKSMHVDI 317 >XP_007735248.1 beta-keto reductase [Capronia epimyces CBS 606.96] EXJ80660.1 beta-keto reductase [Capronia epimyces CBS 606.96] Length = 336 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 GSPYWSHA+V IT +LGPM+ +LLGIN++MHVDI Sbjct: 282 GSPYWSHALVAALITGVLGPMSSILLGINKRMHVDI 317 >XP_016268708.1 hypothetical protein PV06_01071 [Exophiala oligosperma] KIW48492.1 hypothetical protein PV06_01071 [Exophiala oligosperma] Length = 336 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 G+PYWSHAIV IT +LGPMN LLL NRKMHVDI Sbjct: 282 GTPYWSHAIVAALITGVLGPMNGLLLEFNRKMHVDI 317 >KIV84479.1 hypothetical protein PV11_00254 [Exophiala sideris] Length = 336 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 G+PYWSHA+V IT ILGPMN LL NRKMHVDI Sbjct: 282 GTPYWSHALVAAVITGILGPMNSALLSFNRKMHVDI 317 >XP_013316125.1 hypothetical protein PV05_04272 [Exophiala xenobiotica] KIW55541.1 hypothetical protein PV05_04272 [Exophiala xenobiotica] Length = 336 Score = 55.1 bits (131), Expect = 8e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 G+PYWSHA+V IT +LGPMN +LL NR+MHVDI Sbjct: 282 GTPYWSHALVAALITGVLGPMNSMLLEFNRRMHVDI 317 >XP_016240004.1 hypothetical protein PV08_00363 [Exophiala spinifera] KIW19788.1 hypothetical protein PV08_00363 [Exophiala spinifera] Length = 339 Score = 55.1 bits (131), Expect = 8e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 514 GSPYWSHAIVTFGITYILGPMNILLLGINRKMHVDI 407 G+PYWSHAIV IT +LGPM+ LLL NRKMHVDI Sbjct: 282 GTPYWSHAIVAALITGVLGPMSGLLLEFNRKMHVDI 317