BLASTX nr result
ID: Magnolia22_contig00033339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00033339 (340 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010266404.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 7e-09 >XP_010266404.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic isoform X1 [Nelumbo nucifera] Length = 1488 Score = 62.0 bits (149), Expect = 7e-09 Identities = 34/56 (60%), Positives = 41/56 (73%), Gaps = 1/56 (1%) Frame = +3 Query: 3 DKAITADIEGRKEKLEKMKKRGGVLRPRKSFNIGRRKYIRQA-KSDRDNTRLENQA 167 DKAI ADIEGRK+KLEKMKK+G ++RP F +RK+IR+A SD N RL QA Sbjct: 1429 DKAIRADIEGRKQKLEKMKKKGRLVRPGNKFK--KRKFIRRAILSDHSNVRLRGQA 1482