BLASTX nr result
ID: Magnolia22_contig00033038
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00033038 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV30250.1 hypothetical protein F511_40381 [Dorcoceras hygrometr... 55 3e-06 >KZV30250.1 hypothetical protein F511_40381 [Dorcoceras hygrometricum] Length = 440 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -2 Query: 410 RNPKARPLMRDIVDSLEPLQVPVENPSAAASVFYCQQ 300 RNPKARPLMRDIVDSLEPLQVP +P+ ++ +C + Sbjct: 400 RNPKARPLMRDIVDSLEPLQVPCNDPTEKSTFTFCSE 436