BLASTX nr result
ID: Magnolia22_contig00032872
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00032872 (521 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018068967.1 hypothetical protein LY89DRAFT_686305 [Phialoceph... 71 2e-12 OBT63286.1 hypothetical protein VE03_07955 [Pseudogymnoascus sp.... 62 1e-09 KFY09664.1 hypothetical protein V492_05400 [Pseudogymnoascus sp.... 61 4e-09 KZV91721.1 hypothetical protein EXIGLDRAFT_719112 [Exidia glandu... 59 8e-09 XP_007849478.1 hypothetical protein Moror_2911 [Moniliophthora r... 59 1e-08 XP_007353991.1 hypothetical protein AURDEDRAFT_173030 [Auricular... 57 7e-08 KFY69172.1 hypothetical protein V496_00448 [Pseudogymnoascus sp.... 60 1e-07 EGE83992.1 hypothetical protein BDDG_06937 [Blastomyces dermatit... 57 2e-07 KFY41789.1 hypothetical protein V495_04792 [Pseudogymnoascus sp.... 57 2e-07 EEQ92472.2 hypothetical protein BDCG_07592 [Blastomyces dermatit... 57 2e-07 OBT43010.1 hypothetical protein VE00_07355 [Pseudogymnoascus sp.... 57 2e-07 OBT75054.1 hypothetical protein VF21_06512 [Pseudogymnoascus sp.... 56 3e-07 XP_018126464.1 hypothetical protein VE01_09717 [Pseudogymnoascus... 55 3e-07 KIK60794.1 hypothetical protein GYMLUDRAFT_73647 [Gymnopus luxur... 54 4e-07 XP_007340495.1 hypothetical protein AURDEDRAFT_83432 [Auriculari... 57 6e-07 OBT86322.1 hypothetical protein VE02_07426 [Pseudogymnoascus sp.... 55 7e-07 KIL87637.1 hypothetical protein FAVG1_09346 [Fusarium avenaceum] 53 2e-06 CRK14808.1 hypothetical protein BN1708_011269 [Verticillium long... 53 2e-06 KFY11159.1 hypothetical protein V491_07329, partial [Pseudogymno... 55 3e-06 KIK60791.1 hypothetical protein GYMLUDRAFT_595796 [Gymnopus luxu... 55 3e-06 >XP_018068967.1 hypothetical protein LY89DRAFT_686305 [Phialocephala scopiformis] KUJ14612.1 hypothetical protein LY89DRAFT_686305 [Phialocephala scopiformis] Length = 156 Score = 71.2 bits (173), Expect = 2e-12 Identities = 42/110 (38%), Positives = 60/110 (54%), Gaps = 22/110 (20%) Frame = -1 Query: 521 LEDSAVHAVSYRCNNCGRGFSSHQALKKHAKDSSAHPV---------------------- 408 LED +Y C +C + F + AL++H + S+ H Sbjct: 42 LEDHRDSLHNYCCPDCNKRFDFNPALEQHQR-STGHAYCDICEKCFEHKDSVNNHRRALH 100 Query: 407 SPVPHIQTLSNRSSIISEGWGNRPNFQASYGLKMTPEDIKEGNRILDAMQ 258 SP +T +RS I+++GWG+R NFQASYGL+MTPED++EG+ IL AMQ Sbjct: 101 SPDCRNRTTPSRSRIVAKGWGDRHNFQASYGLQMTPEDLEEGDAILKAMQ 150 >OBT63286.1 hypothetical protein VE03_07955 [Pseudogymnoascus sp. 23342-1-I1] Length = 98 Score = 62.4 bits (150), Expect = 1e-09 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 365 IISEGWGNRPNFQASYGLKMTPEDIKEGNRILDAMQ 258 I+ +GWG+RPNFQ S+GL+MTPEDI+EGNRILD + Sbjct: 34 IVKDGWGDRPNFQLSFGLRMTPEDIEEGNRILDGFR 69 >KFY09664.1 hypothetical protein V492_05400 [Pseudogymnoascus sp. VKM F-4246] Length = 97 Score = 60.8 bits (146), Expect = 4e-09 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 365 IISEGWGNRPNFQASYGLKMTPEDIKEGNRILDAMQ 258 I+ +GWG+RPNFQ S+GL+MTPE I+EGNRILDA + Sbjct: 33 IVKDGWGDRPNFQHSFGLRMTPEGIEEGNRILDAFR 68 >KZV91721.1 hypothetical protein EXIGLDRAFT_719112 [Exidia glandulosa HHB12029] Length = 75 Score = 59.3 bits (142), Expect = 8e-09 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -1 Query: 368 SIISEGWGNRPNFQASYGLKMTPEDIKEGNRILDAM 261 S+I +GWG+RPNFQ SYGLKMTPED++EG IL+ + Sbjct: 11 SVIKDGWGSRPNFQYSYGLKMTPEDLEEGEEILNQL 46 >XP_007849478.1 hypothetical protein Moror_2911 [Moniliophthora roreri MCA 2997] ESK91191.1 hypothetical protein Moror_2911 [Moniliophthora roreri MCA 2997] Length = 69 Score = 58.5 bits (140), Expect = 1e-08 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -1 Query: 365 IISEGWGNRPNFQASYGLKMTPEDIKEGNRILDAMQ 258 II +GWGNR NFQ SYGL+MTPED++EG+ ILD ++ Sbjct: 13 IIKDGWGNRVNFQLSYGLRMTPEDLQEGDLILDVLE 48 >XP_007353991.1 hypothetical protein AURDEDRAFT_173030 [Auricularia subglabra TFB-10046 SS5] EJD37889.1 hypothetical protein AURDEDRAFT_173030 [Auricularia subglabra TFB-10046 SS5] Length = 65 Score = 56.6 bits (135), Expect = 7e-08 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -1 Query: 374 RSSIISEGWGNRPNFQASYGLKMTPEDIKEGNRILDAM 261 +SSII GWGNR FQASYGL+M P+DI+EGN IL+ + Sbjct: 9 KSSIIKSGWGNRLMFQASYGLRMDPDDIEEGNLILEEL 46 >KFY69172.1 hypothetical protein V496_00448 [Pseudogymnoascus sp. VKM F-4515 (FW-2607)] KFY94643.1 hypothetical protein V498_03825 [Pseudogymnoascus sp. VKM F-4517 (FW-2822)] Length = 329 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = -1 Query: 365 IISEGWGNRPNFQASYGLKMTPEDIKEGNRILDAMQ 258 I+++GWG+RPNFQ S+GL+MTPE I++GNRILDA + Sbjct: 34 IVNDGWGDRPNFQLSFGLRMTPEGIEKGNRILDAFR 69 >EGE83992.1 hypothetical protein BDDG_06937 [Blastomyces dermatitidis ATCC 18188] EQL35179.1 hypothetical protein BDFG_03160 [Blastomyces dermatitidis ATCC 26199] Length = 98 Score = 56.6 bits (135), Expect = 2e-07 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = -1 Query: 377 NRSSIISEGWGNRPNFQASYGLKMTPEDIKEGNRILDAMQ 258 +++ I+ +GWG+R NFQAS+GL M P+ ++EGNRILDA Q Sbjct: 50 SKARIVKDGWGSRANFQASFGLCMGPDSLEEGNRILDAFQ 89 >KFY41789.1 hypothetical protein V495_04792 [Pseudogymnoascus sp. VKM F-4514 (FW-929)] KFY59378.1 hypothetical protein V497_04344 [Pseudogymnoascus sp. VKM F-4516 (FW-969)] Length = 129 Score = 57.4 bits (137), Expect = 2e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -1 Query: 365 IISEGWGNRPNFQASYGLKMTPEDIKEGNRILDAMQ 258 II +GWG+RP+FQ+S+GL MTPEDI+ GNRILD + Sbjct: 34 IIKDGWGDRPSFQSSFGLGMTPEDIEGGNRILDGFR 69 >EEQ92472.2 hypothetical protein BDCG_07592 [Blastomyces dermatitidis ER-3] Length = 100 Score = 56.6 bits (135), Expect = 2e-07 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = -1 Query: 377 NRSSIISEGWGNRPNFQASYGLKMTPEDIKEGNRILDAMQ 258 +++ I+ +GWG+R NFQAS+GL M P+ ++EGNRILDA Q Sbjct: 52 SKARIVKDGWGSRANFQASFGLCMGPDSLEEGNRILDAFQ 91 >OBT43010.1 hypothetical protein VE00_07355 [Pseudogymnoascus sp. WSF 3629] Length = 101 Score = 56.6 bits (135), Expect = 2e-07 Identities = 29/64 (45%), Positives = 38/64 (59%) Frame = -1 Query: 449 ALKKHAKDSSAHPVSPVPHIQTLSNRSSIISEGWGNRPNFQASYGLKMTPEDIKEGNRIL 270 A + +S+A SP P I+ +GWG+RPNFQ S+GL MTP I+EGNRIL Sbjct: 12 ASQNQESNSNASSDSPPP------TNYRIVKDGWGDRPNFQHSFGLPMTPGGIEEGNRIL 65 Query: 269 DAMQ 258 D + Sbjct: 66 DGFR 69 >OBT75054.1 hypothetical protein VF21_06512 [Pseudogymnoascus sp. 05NY08] Length = 104 Score = 56.2 bits (134), Expect = 3e-07 Identities = 29/64 (45%), Positives = 38/64 (59%) Frame = -1 Query: 449 ALKKHAKDSSAHPVSPVPHIQTLSNRSSIISEGWGNRPNFQASYGLKMTPEDIKEGNRIL 270 A + +S+A SP P I+ +GWG+RPNFQ S+GL MTPE I+EGN IL Sbjct: 12 ASQNQESNSNASSDSPPP------TNYRIVKDGWGDRPNFQHSFGLPMTPEGIEEGNIIL 65 Query: 269 DAMQ 258 D + Sbjct: 66 DGFR 69 >XP_018126464.1 hypothetical protein VE01_09717 [Pseudogymnoascus verrucosus] OBT92731.1 hypothetical protein VE01_09717 [Pseudogymnoascus verrucosus] Length = 83 Score = 55.5 bits (132), Expect = 3e-07 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = -1 Query: 407 SPVPHIQTLSNRSSIISEGWGNRPNFQASYGLKMTPEDIKEGNRILDAMQ 258 +P P + + SSI +GWG+R FQ SYGL MTP+ +EGNRILD+ + Sbjct: 10 TPTPLPASPPSNSSIAKDGWGSRSEFQHSYGLGMTPQGFEEGNRILDSFR 59 >KIK60794.1 hypothetical protein GYMLUDRAFT_73647 [Gymnopus luxurians FD-317 M1] Length = 51 Score = 54.3 bits (129), Expect = 4e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -1 Query: 380 SNRSSIISEGWGNRPNFQASYGLKMTPEDIKEGNRILD 267 SN I GW NRPNFQ S+G KMTP+DI EGNRILD Sbjct: 5 SNYRIIDDGGWTNRPNFQYSHGPKMTPDDIGEGNRILD 42 >XP_007340495.1 hypothetical protein AURDEDRAFT_83432 [Auricularia subglabra TFB-10046 SS5] EJD51096.1 hypothetical protein AURDEDRAFT_83432 [Auricularia subglabra TFB-10046 SS5] Length = 206 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -1 Query: 368 SIISEGWGNRPNFQASYGLKMTPEDIKEGNRILDAMQMGS 249 S++ +GWG RPNFQ S+GLKM P+DI EGN ILD + G+ Sbjct: 8 SVVKQGWGGRPNFQHSHGLKMIPDDIDEGNIILDQILKGA 47 >OBT86322.1 hypothetical protein VE02_07426 [Pseudogymnoascus sp. 03VT05] Length = 104 Score = 55.1 bits (131), Expect = 7e-07 Identities = 28/67 (41%), Positives = 40/67 (59%) Frame = -1 Query: 458 SHQALKKHAKDSSAHPVSPVPHIQTLSNRSSIISEGWGNRPNFQASYGLKMTPEDIKEGN 279 ++ A + +S+A SP P I+ +GWG+RPNFQ S+GL MTPE I+EGN Sbjct: 9 NNAASQNQESNSNASSDSPPP------TNYRIVKDGWGDRPNFQHSFGLPMTPEGIEEGN 62 Query: 278 RILDAMQ 258 IL+ + Sbjct: 63 IILEGFR 69 >KIL87637.1 hypothetical protein FAVG1_09346 [Fusarium avenaceum] Length = 75 Score = 53.1 bits (126), Expect = 2e-06 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = -1 Query: 374 RSSIISEGWGNRPNFQASYGLKMTPEDIKEGNRILDA 264 R ++ +GWG+RP FQ+SYGL M P+ I+EGN ILDA Sbjct: 25 RYRVVKDGWGSRPIFQSSYGLGMDPDSIEEGNAILDA 61 >CRK14808.1 hypothetical protein BN1708_011269 [Verticillium longisporum] CRK43778.1 hypothetical protein BN1723_005828 [Verticillium longisporum] Length = 71 Score = 52.8 bits (125), Expect = 2e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -1 Query: 359 SEGWGNRPNFQASYGLKMTPEDIKEGNRILDAM 261 ++ WG R NFQ SYGLKMTP+DI +GN ILD+M Sbjct: 33 AKAWGGRQNFQHSYGLKMTPDDIAQGNAILDSM 65 >KFY11159.1 hypothetical protein V491_07329, partial [Pseudogymnoascus sp. VKM F-3775] Length = 226 Score = 55.5 bits (132), Expect = 3e-06 Identities = 31/72 (43%), Positives = 40/72 (55%), Gaps = 1/72 (1%) Frame = -1 Query: 368 SIISEGWGNRPNFQASYGLKMTPEDIKEGNRILDAMQMGSYGSYGTLK*HCPRNMDRRCK 189 SI +GWG+R FQ SYGL MTPED +EGNRIL++ C +M+ R K Sbjct: 28 SITKDGWGSRTEFQRSYGLGMTPEDFEEGNRILESF--------------CKADMEEREK 73 Query: 188 SQ-DLLEGTNTL 156 +Q + GT L Sbjct: 74 AQKSIHNGTRNL 85 >KIK60791.1 hypothetical protein GYMLUDRAFT_595796 [Gymnopus luxurians FD-317 M1] Length = 227 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -1 Query: 353 GWGNRPNFQASYGLKMTPEDIKEGNRILDAMQMGSYGSYG 234 GW NRP+FQ S+GLKMTP+DI+EGN ILD +Y S G Sbjct: 14 GWTNRPHFQYSHGLKMTPDDIEEGNLILDEYARHNYNSDG 53