BLASTX nr result
ID: Magnolia22_contig00032847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00032847 (612 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010269891.1 PREDICTED: pentatricopeptide repeat-containing pr... 118 2e-27 XP_010269811.1 PREDICTED: pentatricopeptide repeat-containing pr... 118 2e-27 CBI27550.3 unnamed protein product, partial [Vitis vinifera] 114 3e-27 XP_010655221.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 2e-26 OMO60415.1 hypothetical protein CCACVL1_24177 [Corchorus capsula... 114 7e-26 KNA16143.1 hypothetical protein SOVF_091790 [Spinacia oleracea] 113 1e-25 XP_017971474.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 1e-25 EOY00825.1 Tetratricopeptide repeat (TPR)-like superfamily prote... 112 1e-25 GAV62334.1 PPR domain-containing protein/PPR_2 domain-containing... 112 1e-25 OMO81425.1 hypothetical protein COLO4_23614 [Corchorus olitorius] 112 2e-25 XP_018857296.1 PREDICTED: pentatricopeptide repeat-containing pr... 111 5e-25 EEF47555.1 pentatricopeptide repeat-containing protein, putative... 110 9e-25 XP_015572108.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 1e-24 XP_010682866.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 3e-24 XP_012479211.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 3e-24 XP_016692971.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 4e-24 XP_016665991.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 4e-24 XP_011041570.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 7e-24 XP_002315631.2 hypothetical protein POPTR_0010s06570g [Populus t... 107 8e-24 XP_006341756.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 1e-23 >XP_010269891.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X2 [Nelumbo nucifera] Length = 524 Score = 118 bits (295), Expect = 2e-27 Identities = 59/123 (47%), Positives = 80/123 (65%), Gaps = 4/123 (3%) Frame = -2 Query: 359 SPFHQFAT----VATTHREGQQNPIEDSYEKEHAHKIFNLVSEVRFGKTDDDILDSLLND 192 SP H F + + G Q +DS + ++ + +V++VR G +++ L LL D Sbjct: 37 SPLHLFGGDGFFCSIRNLTGHQRQCQDSTSRVESY-LEKVVNKVRVGSNENEFLQYLLQD 95 Query: 191 QDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSRPGYRHSPEAYDKMVDILGKAKQI 12 Q CC+IQ S+ VD LL F DDW+SALGLFRWA SRP Y+HSPE Y+KMVDILGK KQ+ Sbjct: 96 QSCCSIQLSDQLVDKLLNIFEDDWRSALGLFRWAGSRPTYKHSPEVYNKMVDILGKMKQM 155 Query: 11 EKM 3 ++M Sbjct: 156 DRM 158 >XP_010269811.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X1 [Nelumbo nucifera] Length = 541 Score = 118 bits (295), Expect = 2e-27 Identities = 59/123 (47%), Positives = 80/123 (65%), Gaps = 4/123 (3%) Frame = -2 Query: 359 SPFHQFAT----VATTHREGQQNPIEDSYEKEHAHKIFNLVSEVRFGKTDDDILDSLLND 192 SP H F + + G Q +DS + ++ + +V++VR G +++ L LL D Sbjct: 54 SPLHLFGGDGFFCSIRNLTGHQRQCQDSTSRVESY-LEKVVNKVRVGSNENEFLQYLLQD 112 Query: 191 QDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSRPGYRHSPEAYDKMVDILGKAKQI 12 Q CC+IQ S+ VD LL F DDW+SALGLFRWA SRP Y+HSPE Y+KMVDILGK KQ+ Sbjct: 113 QSCCSIQLSDQLVDKLLNIFEDDWRSALGLFRWAGSRPTYKHSPEVYNKMVDILGKMKQM 172 Query: 11 EKM 3 ++M Sbjct: 173 DRM 175 >CBI27550.3 unnamed protein product, partial [Vitis vinifera] Length = 330 Score = 114 bits (286), Expect = 3e-27 Identities = 53/84 (63%), Positives = 65/84 (77%) Frame = -2 Query: 254 LVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSRPG 75 +VS +R G +DD++ SL++D+ C AI S + VD LL RF DDWKSALGLFRWA SR G Sbjct: 48 IVSRIREGSSDDEVFKSLVHDEACNAIPMSQNLVDVLLHRFKDDWKSALGLFRWAESRLG 107 Query: 74 YRHSPEAYDKMVDILGKAKQIEKM 3 Y H+PEAYD MVDILGK KQ++KM Sbjct: 108 YEHAPEAYDMMVDILGKLKQVDKM 131 >XP_010655221.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Vitis vinifera] XP_010655231.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Vitis vinifera] Length = 496 Score = 114 bits (286), Expect = 2e-26 Identities = 53/84 (63%), Positives = 65/84 (77%) Frame = -2 Query: 254 LVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSRPG 75 +VS +R G +DD++ SL++D+ C AI S + VD LL RF DDWKSALGLFRWA SR G Sbjct: 48 IVSRIREGSSDDEVFKSLVHDEACNAIPMSQNLVDVLLHRFKDDWKSALGLFRWAESRLG 107 Query: 74 YRHSPEAYDKMVDILGKAKQIEKM 3 Y H+PEAYD MVDILGK KQ++KM Sbjct: 108 YEHAPEAYDMMVDILGKLKQVDKM 131 >OMO60415.1 hypothetical protein CCACVL1_24177 [Corchorus capsularis] Length = 794 Score = 114 bits (285), Expect = 7e-26 Identities = 54/109 (49%), Positives = 74/109 (67%) Frame = -2 Query: 329 TTHREGQQNPIEDSYEKEHAHKIFNLVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSFVD 150 + H+ G+Q I+ LV +VR G++DD++ L +D C A+ S+ VD Sbjct: 336 SAHQAGEQRDIDI------------LVGKVRAGRSDDEVFQCLASDPKCNAVHLSHDLVD 383 Query: 149 NLLQRFNDDWKSALGLFRWASSRPGYRHSPEAYDKMVDILGKAKQIEKM 3 LL RFNDDWKSALG FRWA++RPGY+HSP+AYD MVDILGK K++++M Sbjct: 384 KLLHRFNDDWKSALGAFRWATTRPGYKHSPQAYDTMVDILGKMKRMDQM 432 >KNA16143.1 hypothetical protein SOVF_091790 [Spinacia oleracea] Length = 538 Score = 113 bits (282), Expect = 1e-25 Identities = 56/117 (47%), Positives = 78/117 (66%) Frame = -2 Query: 353 FHQFATVATTHREGQQNPIEDSYEKEHAHKIFNLVSEVRFGKTDDDILDSLLNDQDCCAI 174 + +F+T + +NPIE S ++ +V++V G ++D+IL L+ND+ C I Sbjct: 46 YAKFSTYSPLGTSQFKNPIESS-------ELQLVVNKVHVGSSEDEILSYLVNDEVCEGI 98 Query: 173 QPSNSFVDNLLQRFNDDWKSALGLFRWASSRPGYRHSPEAYDKMVDILGKAKQIEKM 3 S++ VD+LL RF DDWKSALG+FRW SRP + H PEAYD MVDILGKA+Q +KM Sbjct: 99 SVSHALVDSLLHRFKDDWKSALGVFRWTESRPNFEHLPEAYDSMVDILGKARQFDKM 155 >XP_017971474.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Theobroma cacao] XP_007044993.2 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Theobroma cacao] XP_017971475.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Theobroma cacao] Length = 504 Score = 112 bits (281), Expect = 1e-25 Identities = 52/106 (49%), Positives = 73/106 (68%), Gaps = 6/106 (5%) Frame = -2 Query: 302 PIEDSYEKEHAHKIFN------LVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLL 141 P+E SY H++ L+ +VR G + +++ L++D++C AIQ S+ V+ LL Sbjct: 37 PVESSYFSGSGHQVVGQYDIDVLIGKVRVGSSHEEVFQCLMSDRECNAIQLSHDLVEKLL 96 Query: 140 QRFNDDWKSALGLFRWASSRPGYRHSPEAYDKMVDILGKAKQIEKM 3 RFNDDWKSALG F+WA+S PGY+ SP+AYD MVDILGK KQ++ M Sbjct: 97 HRFNDDWKSALGAFKWAASHPGYKPSPQAYDLMVDILGKMKQMDHM 142 >EOY00825.1 Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 504 Score = 112 bits (281), Expect = 1e-25 Identities = 52/106 (49%), Positives = 73/106 (68%), Gaps = 6/106 (5%) Frame = -2 Query: 302 PIEDSYEKEHAHKIFN------LVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLL 141 P+E SY H++ L+ +VR G + +++ L++D++C AIQ S+ V+ LL Sbjct: 37 PVESSYFSGSGHQVVGQYDIDVLIGKVRVGSSHEEVFQCLMSDRECNAIQLSHDLVEKLL 96 Query: 140 QRFNDDWKSALGLFRWASSRPGYRHSPEAYDKMVDILGKAKQIEKM 3 RFNDDWKSALG F+WA+S PGY+ SP+AYD MVDILGK KQ++ M Sbjct: 97 HRFNDDWKSALGAFKWAASHPGYKPSPQAYDLMVDILGKMKQMDHM 142 >GAV62334.1 PPR domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein [Cephalotus follicularis] Length = 522 Score = 112 bits (281), Expect = 1e-25 Identities = 47/84 (55%), Positives = 68/84 (80%) Frame = -2 Query: 254 LVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSRPG 75 ++S++ GKTDD++ L++DQ C A+Q S+ V NLL RF +DWKSALG+FRWA SRPG Sbjct: 77 VISKIPVGKTDDEVFQRLIHDQACSAVQLSHRLVINLLHRFKNDWKSALGVFRWAESRPG 136 Query: 74 YRHSPEAYDKMVDILGKAKQIEKM 3 Y+H+P++YD +VDI+GK KQ+++M Sbjct: 137 YKHTPDSYDMIVDIMGKMKQMDRM 160 >OMO81425.1 hypothetical protein COLO4_23614 [Corchorus olitorius] Length = 504 Score = 112 bits (280), Expect = 2e-25 Identities = 54/114 (47%), Positives = 73/114 (64%) Frame = -2 Query: 344 FATVATTHREGQQNPIEDSYEKEHAHKIFNLVSEVRFGKTDDDILDSLLNDQDCCAIQPS 165 F + H+ G+Q I+ LV +VR G++DD++ L +D C A+ S Sbjct: 41 FVATGSAHQAGEQRDIDI------------LVGKVRAGRSDDEVFQCLASDPKCNAVHLS 88 Query: 164 NSFVDNLLQRFNDDWKSALGLFRWASSRPGYRHSPEAYDKMVDILGKAKQIEKM 3 + VD LL RFNDDWKSALG FRWA++ P Y+HSP+AYD MVDILGK KQ+++M Sbjct: 89 HDLVDKLLHRFNDDWKSALGAFRWATTCPDYKHSPQAYDTMVDILGKMKQMDQM 142 >XP_018857296.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Juglans regia] Length = 511 Score = 111 bits (277), Expect = 5e-25 Identities = 55/111 (49%), Positives = 76/111 (68%), Gaps = 10/111 (9%) Frame = -2 Query: 305 NPIEDSYEKEHAHK----------IFNLVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSF 156 +P+E S H H+ + LV++V FG +D+++L SL +DQ C +I S+ Sbjct: 39 SPLESSSLTRHEHQQCQDSKRLSELDILVAKVPFGTSDEEVLRSLSHDQACNSIGLSSDL 98 Query: 155 VDNLLQRFNDDWKSALGLFRWASSRPGYRHSPEAYDKMVDILGKAKQIEKM 3 V+ LL RF DDWKSALG+FRWA SR GY+H+PEAY+ +VDILGK KQ++KM Sbjct: 99 VEKLLHRFKDDWKSALGVFRWAESRSGYKHTPEAYEMLVDILGKMKQMDKM 149 >EEF47555.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 466 Score = 110 bits (274), Expect = 9e-25 Identities = 49/84 (58%), Positives = 67/84 (79%) Frame = -2 Query: 254 LVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSRPG 75 +V+++R G + D+I+ SL++D+ C +I S+ VD LL RF DDWKSALG+FRWA SR G Sbjct: 21 IVAKIRVGSSHDEIVQSLVHDEVCNSIHLSHELVDKLLFRFKDDWKSALGVFRWAESRAG 80 Query: 74 YRHSPEAYDKMVDILGKAKQIEKM 3 Y+HSPEAYD MVDI+GK KQ+++M Sbjct: 81 YKHSPEAYDTMVDIMGKMKQMDQM 104 >XP_015572108.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Ricinus communis] Length = 522 Score = 110 bits (274), Expect = 1e-24 Identities = 49/84 (58%), Positives = 67/84 (79%) Frame = -2 Query: 254 LVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSRPG 75 +V+++R G + D+I+ SL++D+ C +I S+ VD LL RF DDWKSALG+FRWA SR G Sbjct: 77 IVAKIRVGSSHDEIVQSLVHDEVCNSIHLSHELVDKLLFRFKDDWKSALGVFRWAESRAG 136 Query: 74 YRHSPEAYDKMVDILGKAKQIEKM 3 Y+HSPEAYD MVDI+GK KQ+++M Sbjct: 137 YKHSPEAYDTMVDIMGKMKQMDQM 160 >XP_010682866.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Beta vulgaris subsp. vulgaris] XP_010682867.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Beta vulgaris subsp. vulgaris] XP_010682868.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Beta vulgaris subsp. vulgaris] XP_010682869.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Beta vulgaris subsp. vulgaris] KMT07543.1 hypothetical protein BVRB_6g151540 [Beta vulgaris subsp. vulgaris] Length = 532 Score = 109 bits (272), Expect = 3e-24 Identities = 48/84 (57%), Positives = 64/84 (76%) Frame = -2 Query: 254 LVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSRPG 75 L S++ G +D++L SL+ND+ C A+ S++ VD LL RF +DWK+ALG+FRWA SRP Sbjct: 67 LASKIHVGSNEDEVLSSLMNDEVCEAVSISHALVDMLLHRFENDWKAALGIFRWAKSRPH 126 Query: 74 YRHSPEAYDKMVDILGKAKQIEKM 3 + H PEAYD MVDILGKA+Q +KM Sbjct: 127 FEHLPEAYDSMVDILGKARQFDKM 150 >XP_012479211.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Gossypium raimondii] XP_012479212.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Gossypium raimondii] XP_012479213.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Gossypium raimondii] XP_012479214.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Gossypium raimondii] XP_012479215.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Gossypium raimondii] KJB30950.1 hypothetical protein B456_005G172000 [Gossypium raimondii] KJB30951.1 hypothetical protein B456_005G172000 [Gossypium raimondii] KJB30952.1 hypothetical protein B456_005G172000 [Gossypium raimondii] KJB30953.1 hypothetical protein B456_005G172000 [Gossypium raimondii] Length = 504 Score = 108 bits (271), Expect = 3e-24 Identities = 48/84 (57%), Positives = 66/84 (78%) Frame = -2 Query: 254 LVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSRPG 75 LVS+V G ++D++ L+ND +C +IQ S+ +D LL+RF DDWKSALG F+WA+SRP Sbjct: 59 LVSKVHAGTSEDEVFQCLVNDGECNSIQLSHDLIDKLLRRFKDDWKSALGAFKWAASRPD 118 Query: 74 YRHSPEAYDKMVDILGKAKQIEKM 3 Y+HS +AYD MVDILGK KQ+++M Sbjct: 119 YKHSHQAYDTMVDILGKMKQMDRM 142 >XP_016692971.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Gossypium hirsutum] Length = 504 Score = 108 bits (270), Expect = 4e-24 Identities = 48/84 (57%), Positives = 65/84 (77%) Frame = -2 Query: 254 LVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSRPG 75 LVS+V G ++D++ L+ND +C +IQ S+ +D LL RF DDWKSALG F+WA+SRP Sbjct: 59 LVSKVHAGTSEDEVFQCLVNDGECNSIQLSHDLIDKLLHRFKDDWKSALGAFKWAASRPD 118 Query: 74 YRHSPEAYDKMVDILGKAKQIEKM 3 Y+HS +AYD MVDILGK KQ+++M Sbjct: 119 YKHSHQAYDTMVDILGKMKQMDRM 142 >XP_016665991.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Gossypium hirsutum] XP_016665992.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Gossypium hirsutum] XP_017617346.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Gossypium arboreum] XP_017617347.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Gossypium arboreum] Length = 504 Score = 108 bits (270), Expect = 4e-24 Identities = 48/84 (57%), Positives = 65/84 (77%) Frame = -2 Query: 254 LVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSRPG 75 LVS+V G ++D++ L+ND +C +IQ S+ +D LL RF DDWKSALG F+WA+SRP Sbjct: 59 LVSKVHAGTSEDEVFQCLVNDGECNSIQLSHDLIDKLLHRFRDDWKSALGAFKWAASRPD 118 Query: 74 YRHSPEAYDKMVDILGKAKQIEKM 3 Y+HS +AYD MVDILGK KQ+++M Sbjct: 119 YKHSHQAYDTMVDILGKMKQMDRM 142 >XP_011041570.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Populus euphratica] Length = 526 Score = 108 bits (269), Expect = 7e-24 Identities = 53/86 (61%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = -2 Query: 257 NLVS-EVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSR 81 NLV+ + R G + D+IL SL ++Q C I+ SN VD LL RF DDWKSALG+FRWA R Sbjct: 67 NLVAAKARVGSSPDEILLSLAHEQVCHNIEVSNDLVDKLLLRFKDDWKSALGIFRWAGLR 126 Query: 80 PGYRHSPEAYDKMVDILGKAKQIEKM 3 PGY+H PEAYD MVDILGK KQ+++M Sbjct: 127 PGYKHRPEAYDMMVDILGKMKQMDQM 152 >XP_002315631.2 hypothetical protein POPTR_0010s06570g [Populus trichocarpa] EEF01802.2 hypothetical protein POPTR_0010s06570g [Populus trichocarpa] Length = 513 Score = 107 bits (268), Expect = 8e-24 Identities = 53/86 (61%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = -2 Query: 257 NLVS-EVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSR 81 NLV+ + R G + D+IL SL ++Q C I+ SN VD LL RF DDWKSALG+FRWA R Sbjct: 67 NLVAAKARVGSSPDEILLSLADEQVCDNIEVSNDLVDKLLLRFKDDWKSALGVFRWAGLR 126 Query: 80 PGYRHSPEAYDKMVDILGKAKQIEKM 3 PGY+H PEAYD MVDILGK KQ+++M Sbjct: 127 PGYKHRPEAYDMMVDILGKMKQMDQM 152 >XP_006341756.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Solanum tuberosum] Length = 522 Score = 107 bits (267), Expect = 1e-23 Identities = 48/84 (57%), Positives = 66/84 (78%) Frame = -2 Query: 254 LVSEVRFGKTDDDILDSLLNDQDCCAIQPSNSFVDNLLQRFNDDWKSALGLFRWASSRPG 75 +++ + G ++D++L SLL+D C +IQ S++FV+ +L RF DDWKSALG FRWA SRP Sbjct: 74 VLARISHGTSEDEVLQSLLSDPACDSIQISDNFVNRVLYRFKDDWKSALGAFRWAQSRPN 133 Query: 74 YRHSPEAYDKMVDILGKAKQIEKM 3 Y+ SPE YDK+VDILGK K++EKM Sbjct: 134 YKPSPELYDKLVDILGKMKKMEKM 157