BLASTX nr result
ID: Magnolia22_contig00032773
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00032773 (389 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007921151.1 hypothetical protein MYCFIDRAFT_209633 [Pseudocer... 69 2e-11 KXT06534.1 hypothetical protein AC578_6106 [Mycosphaerella eumusae] 67 6e-11 KXT17908.1 hypothetical protein AC579_5930 [Pseudocercospora musae] 68 9e-11 XP_020072053.1 hypothetical protein CYBJADRAFT_114644, partial [... 61 5e-10 XP_007672273.1 hypothetical protein BAUCODRAFT_194898 [Baudoinia... 63 4e-09 OGE48160.1 hypothetical protein PENARI_c031G02386 [Penicillium a... 61 2e-08 CEP21331.1 unnamed protein product [Cyberlindnera jadinii] 61 2e-08 XP_001384193.2 hypothetical protein PICST_89256 [Scheffersomyces... 60 5e-08 XP_002848531.1 CPCA [Arthroderma otae CBS 113480] EEQ28646.1 CPC... 60 6e-08 KUM58036.1 hypothetical protein ACN42_g9130 [Penicillium freii] 60 7e-08 KGO78519.1 hypothetical protein PITC_067860 [Penicillium italicum] 59 9e-08 CEO60203.1 hypothetical protein PMG11_04841 [Penicillium brasili... 59 1e-07 XP_003959793.1 hypothetical protein KAFR_0L00510 [Kazachstania a... 59 1e-07 KGO68754.1 hypothetical protein PEX1_034760 [Penicillium expansum] 59 1e-07 XP_016593371.1 hypothetical protein PEX2_102940 [Penicillium exp... 59 1e-07 XP_014536028.1 Cross-pathway control protein A [Penicillium digi... 59 1e-07 KXG50818.1 bZIP transcription factor, bZIP-1 [Penicillium griseo... 59 1e-07 CRL23612.1 Basic-leucine zipper (bZIP) transcription factor [Pen... 59 1e-07 GAM87763.1 hypothetical protein ANO11243_057900 [fungal sp. No.1... 58 2e-07 KOS46565.1 hypothetical protein ACN38_g2469 [Penicillium nordicum] 59 2e-07 >XP_007921151.1 hypothetical protein MYCFIDRAFT_209633 [Pseudocercospora fijiensis CIRAD86] EME87861.1 hypothetical protein MYCFIDRAFT_209633 [Pseudocercospora fijiensis CIRAD86] Length = 243 Score = 68.6 bits (166), Expect = 2e-11 Identities = 40/67 (59%), Positives = 47/67 (70%) Frame = -2 Query: 388 VDTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAMLITL 209 VD NDPVALKRARNTAAARKSR KKVQER+ LE ++AAL AE+E K ++L Sbjct: 183 VDENDPVALKRARNTAAARKSRAKKVQERDGLEGQIAAL-------KAEVEFWKQKAVSL 235 Query: 208 GHQPSES 188 G S+S Sbjct: 236 GADASDS 242 >KXT06534.1 hypothetical protein AC578_6106 [Mycosphaerella eumusae] Length = 244 Score = 67.4 bits (163), Expect = 6e-11 Identities = 39/67 (58%), Positives = 47/67 (70%) Frame = -2 Query: 388 VDTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAMLITL 209 VD NDPVALKRARNTAAARKSR KKVQER+ LE ++AAL AE+E K ++L Sbjct: 184 VDENDPVALKRARNTAAARKSRAKKVQERDGLEDQIAAL-------KAEVEFWKQKAVSL 236 Query: 208 GHQPSES 188 G ++S Sbjct: 237 GADVADS 243 >KXT17908.1 hypothetical protein AC579_5930 [Pseudocercospora musae] Length = 373 Score = 67.8 bits (164), Expect = 9e-11 Identities = 39/67 (58%), Positives = 47/67 (70%) Frame = -2 Query: 388 VDTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAMLITL 209 VD NDPVALKRARNTAAARKSR KKVQER+ LE ++AAL AE+E K ++L Sbjct: 313 VDENDPVALKRARNTAAARKSRAKKVQERDGLEDQIAAL-------KAEVEFWKQKAVSL 365 Query: 208 GHQPSES 188 G ++S Sbjct: 366 GADAADS 372 >XP_020072053.1 hypothetical protein CYBJADRAFT_114644, partial [Cyberlindnera jadinii NRRL Y-1542] ODV75014.1 hypothetical protein CYBJADRAFT_114644, partial [Cyberlindnera jadinii NRRL Y-1542] Length = 62 Score = 60.8 bits (146), Expect = 5e-10 Identities = 30/57 (52%), Positives = 42/57 (73%) Frame = -2 Query: 388 VDTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAML 218 VD++DP+A KRARNT AAR+SR +K++ LE KV L E+ E + E+ERL+A+L Sbjct: 3 VDSSDPIAAKRARNTEAARRSRARKMERMSQLEDKVEELQEKNEALEQEVERLRALL 59 >XP_007672273.1 hypothetical protein BAUCODRAFT_194898 [Baudoinia panamericana UAMH 10762] EMD01089.1 hypothetical protein BAUCODRAFT_194898 [Baudoinia panamericana UAMH 10762] Length = 286 Score = 62.8 bits (151), Expect = 4e-09 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = -2 Query: 385 DTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAML 218 D ND V LKRARNTAAARKSR KKVQERE LE +++ ELE K+ E+E A+L Sbjct: 207 DENDQVGLKRARNTAAARKSRAKKVQEREELEGRIS----ELEQKNVEVEERYAVL 258 >OGE48160.1 hypothetical protein PENARI_c031G02386 [Penicillium arizonense] Length = 440 Score = 61.2 bits (147), Expect = 2e-08 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = -2 Query: 385 DTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAML 218 D NDPVA KRARNT AARKSR KK++ + V E ++ L + + +DAEI +LKA L Sbjct: 378 DPNDPVAAKRARNTEAARKSRAKKMERQAVSERRIEELEDIIAARDAEIAKLKAQL 433 >CEP21331.1 unnamed protein product [Cyberlindnera jadinii] Length = 295 Score = 60.8 bits (146), Expect = 2e-08 Identities = 30/57 (52%), Positives = 42/57 (73%) Frame = -2 Query: 388 VDTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAML 218 VD++DP+A KRARNT AAR+SR +K++ LE KV L E+ E + E+ERL+A+L Sbjct: 236 VDSSDPIAAKRARNTEAARRSRARKMERMSQLEDKVEELQEKNEALEQEVERLRALL 292 >XP_001384193.2 hypothetical protein PICST_89256 [Scheffersomyces stipitis CBS 6054] ABN66164.2 transcriptional activator of amino acid biosynthetic genes [Scheffersomyces stipitis CBS 6054] Length = 277 Score = 59.7 bits (143), Expect = 5e-08 Identities = 30/63 (47%), Positives = 41/63 (65%) Frame = -2 Query: 385 DTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAMLITLG 206 D+ DP+ LKRA+NT AAR+SR +K++ LETKV L E + E+ RLK ML+ G Sbjct: 215 DSADPITLKRAKNTEAARRSRARKMERMNQLETKVEELIHEKSTLELEVLRLKEMLLANG 274 Query: 205 HQP 197 +P Sbjct: 275 IKP 277 >XP_002848531.1 CPCA [Arthroderma otae CBS 113480] EEQ28646.1 CPCA [Arthroderma otae CBS 113480] Length = 335 Score = 59.7 bits (143), Expect = 6e-08 Identities = 30/56 (53%), Positives = 40/56 (71%) Frame = -2 Query: 388 VDTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAM 221 VDT+DPVA+KRARNT AARKSR +KV+ +E LE ++ L ELE ++E K + Sbjct: 274 VDTSDPVAVKRARNTEAARKSRARKVELQESLERRIEELETELEQARQQVEHWKGV 329 >KUM58036.1 hypothetical protein ACN42_g9130 [Penicillium freii] Length = 448 Score = 59.7 bits (143), Expect = 7e-08 Identities = 30/56 (53%), Positives = 39/56 (69%) Frame = -2 Query: 385 DTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAML 218 D NDPVA KRARNT AARKSR KK++ + E ++ L + + +DAEI +LKA L Sbjct: 386 DPNDPVAAKRARNTEAARKSRAKKMERQYTSERRIEDLQKVIAERDAEIAKLKAQL 441 >KGO78519.1 hypothetical protein PITC_067860 [Penicillium italicum] Length = 470 Score = 59.3 bits (142), Expect = 9e-08 Identities = 30/56 (53%), Positives = 39/56 (69%) Frame = -2 Query: 385 DTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAML 218 D NDPVA KRARNT AARKSR KK++ + E ++ L + + +DAEI +LKA L Sbjct: 408 DPNDPVAAKRARNTEAARKSRAKKMERQYTSERRIEDLQKIIAERDAEIAKLKAQL 463 >CEO60203.1 hypothetical protein PMG11_04841 [Penicillium brasilianum] Length = 244 Score = 58.5 bits (140), Expect = 1e-07 Identities = 32/58 (55%), Positives = 38/58 (65%) Frame = -2 Query: 385 DTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAMLIT 212 D DPVA KRARNT AARKSR KK+Q + E ++A L +LE AE +LKA L T Sbjct: 182 DPTDPVAAKRARNTEAARKSRAKKLQRQMSAEAQIADLRRQLEESRAENAKLKAQLQT 239 >XP_003959793.1 hypothetical protein KAFR_0L00510 [Kazachstania africana CBS 2517] CCF60658.1 hypothetical protein KAFR_0L00510 [Kazachstania africana CBS 2517] Length = 255 Score = 58.5 bits (140), Expect = 1e-07 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = -2 Query: 385 DTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAMLITLG 206 D +DPVALKRARNT AAR+SR +K+Q LETKV L E + E+ RL+++L + G Sbjct: 193 DPSDPVALKRARNTEAARRSRARKLQRMNQLETKVENLISENSDLQNEVARLRSLLESNG 252 >KGO68754.1 hypothetical protein PEX1_034760 [Penicillium expansum] Length = 448 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/56 (51%), Positives = 39/56 (69%) Frame = -2 Query: 385 DTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAML 218 D NDP+A KRARNT AARKSR KK++ + E ++ L + + +DAEI +LKA L Sbjct: 386 DPNDPIAAKRARNTEAARKSRAKKMERQYTSERRIEDLQKIIAERDAEIAKLKAQL 441 >XP_016593371.1 hypothetical protein PEX2_102940 [Penicillium expansum] KGO37988.1 hypothetical protein PEXP_080040 [Penicillium expansum] KGO49990.1 hypothetical protein PEX2_102940 [Penicillium expansum] Length = 448 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/56 (51%), Positives = 39/56 (69%) Frame = -2 Query: 385 DTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAML 218 D NDP+A KRARNT AARKSR KK++ + E ++ L + + +DAEI +LKA L Sbjct: 386 DPNDPIAAKRARNTEAARKSRAKKMERQYTSERRIEDLQKIIAERDAEIAKLKAQL 441 >XP_014536028.1 Cross-pathway control protein A [Penicillium digitatum Pd1] EKV04655.1 Cross-pathway control protein A [Penicillium digitatum PHI26] EKV16836.1 Cross-pathway control protein A [Penicillium digitatum Pd1] Length = 448 Score = 58.9 bits (141), Expect = 1e-07 Identities = 30/56 (53%), Positives = 39/56 (69%) Frame = -2 Query: 385 DTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAML 218 D NDPVA KRARNT AARKSR KK++ + E ++ L + + +DAEI +LKA L Sbjct: 386 DPNDPVAAKRARNTEAARKSRAKKMERQFTSERRIEDLQKIIAERDAEIAKLKAQL 441 >KXG50818.1 bZIP transcription factor, bZIP-1 [Penicillium griseofulvum] Length = 454 Score = 58.9 bits (141), Expect = 1e-07 Identities = 30/56 (53%), Positives = 39/56 (69%) Frame = -2 Query: 385 DTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAML 218 D NDPVA KRARNT AARKSR KK++ + E ++ L + + +DAEI +LKA L Sbjct: 392 DPNDPVAAKRARNTEAARKSRAKKMERQFTSERRIEDLQKIIAERDAEIAKLKAQL 447 >CRL23612.1 Basic-leucine zipper (bZIP) transcription factor [Penicillium camemberti] Length = 467 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/56 (51%), Positives = 39/56 (69%) Frame = -2 Query: 385 DTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAML 218 D NDP+A KRARNT AARKSR KK++ + E ++ L + + +DAEI +LKA L Sbjct: 405 DPNDPIAAKRARNTEAARKSRAKKMERQYTSERRIEDLQKIIAERDAEIAKLKAQL 460 >GAM87763.1 hypothetical protein ANO11243_057900 [fungal sp. No.11243] Length = 231 Score = 57.8 bits (138), Expect = 2e-07 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -2 Query: 388 VDTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELEN 254 VD+ DPVA+KRARNTAAARKSRDKK +E E ++A L +E+E+ Sbjct: 176 VDSADPVAVKRARNTAAARKSRDKKFKEVETYRLRIAELEQEVEH 220 >KOS46565.1 hypothetical protein ACN38_g2469 [Penicillium nordicum] Length = 454 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/56 (51%), Positives = 39/56 (69%) Frame = -2 Query: 385 DTNDPVALKRARNTAAARKSRDKKVQEREVLETKVAALTEELENKDAEIERLKAML 218 D NDP+A KRARNT AARKSR KK++ + E ++ L + + +DAEI +LKA L Sbjct: 392 DPNDPIAAKRARNTEAARKSRAKKMERQYTSERRIDDLQKIIAERDAEIAKLKAQL 447