BLASTX nr result
ID: Magnolia22_contig00032770
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00032770 (410 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007784512.1 60S ribosomal protein L38 [Coniosporium apollinis... 65 3e-11 KKY29057.1 putative 60s ribosomal protein l38 [Phaeomoniella chl... 65 4e-11 XP_007786076.1 60S ribosomal protein L38 [Endocarpon pusillum Z0... 64 4e-11 EQL02373.1 Ribosomal protein L38e [Ophiocordyceps sinensis CO18] 63 2e-10 XP_018190303.1 putative 60S ribosomal protein L38 [Xylona heveae... 62 5e-10 OCK98749.1 ribosomal protein L38e [Cenococcum geophilum 1.58] 61 7e-10 OCK77239.1 ribosomal protein L38e [Lepidopterella palustris CBS ... 61 7e-10 XP_752041.1 60S ribosomal protein L38 [Aspergillus fumigatus Af2... 61 1e-09 XP_001267237.1 60S ribosomal protein L38 [Aspergillus fischeri N... 61 1e-09 KZZ95667.1 60S ribosomal protein L38 [Ascosphaera apis ARSEF 7405] 62 1e-09 OIW30258.1 ribosomal protein L38e [Coniochaeta ligniaria NRRL 30... 61 1e-09 XP_018701667.1 Ribosomal protein L38e [Isaria fumosorosea ARSEF ... 60 1e-09 KEY68031.1 hypothetical protein S7711_06944 [Stachybotrys charta... 60 1e-09 XP_008601140.1 ribosomal protein L38e [Beauveria bassiana ARSEF ... 60 1e-09 OAA69287.1 Ribosomal protein L38e [Cordyceps confragosa RCEF 100... 60 1e-09 XP_001229025.1 60S ribosomal protein L38 [Chaetomium globosum CB... 60 1e-09 XP_003661488.1 hypothetical protein MYCTH_79440 [Thermothelomyce... 60 1e-09 XP_003649013.1 60S ribosomal protein L38 [Thielavia terrestris N... 60 1e-09 KND91978.1 60S ribosomal protein L38 [Tolypocladium ophioglossoi... 60 2e-09 CRG88018.1 large subunit ribosomal protein L38e [Talaromyces isl... 61 2e-09 >XP_007784512.1 60S ribosomal protein L38 [Coniosporium apollinis CBS 100218] EON69195.1 60S ribosomal protein L38 [Coniosporium apollinis CBS 100218] Length = 78 Score = 64.7 bits (156), Expect = 3e-11 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRCHRYLYTL+LKD ++KA+K+KQSLPP L +NE+ Sbjct: 34 IKFKVRCHRYLYTLVLKD--SDKAEKLKQSLPPGLTINEV 71 >KKY29057.1 putative 60s ribosomal protein l38 [Phaeomoniella chlamydospora] Length = 88 Score = 64.7 bits (156), Expect = 4e-11 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFK+RCHR++YTL+LKDA +KADK+KQSLPP++QV EI Sbjct: 41 IKFKIRCHRFVYTLVLKDA--DKADKLKQSLPPNMQVTEI 78 >XP_007786076.1 60S ribosomal protein L38 [Endocarpon pusillum Z07020] ERF76552.1 60S ribosomal protein L38 [Endocarpon pusillum Z07020] Length = 81 Score = 64.3 bits (155), Expect = 4e-11 Identities = 28/40 (70%), Positives = 37/40 (92%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFK+RCHR+LYTL+LKD ++KADK+KQSLPPSL ++E+ Sbjct: 34 IKFKIRCHRFLYTLVLKD--SDKADKLKQSLPPSLNISEV 71 >EQL02373.1 Ribosomal protein L38e [Ophiocordyceps sinensis CO18] Length = 75 Score = 62.8 bits (151), Expect = 2e-10 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 +KFKVRC RYLYTL+LKD TEKA+K+KQSLPP+LQ+ ++ Sbjct: 34 VKFKVRCQRYLYTLVLKD--TEKAEKLKQSLPPNLQITDL 71 >XP_018190303.1 putative 60S ribosomal protein L38 [Xylona heveae TC161] KZF24748.1 putative 60S ribosomal protein L38 [Xylona heveae TC161] Length = 82 Score = 61.6 bits (148), Expect = 5e-10 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRC RYLYTL+LKDA +KA+K+KQSLPPSL ++++ Sbjct: 34 IKFKVRCQRYLYTLVLKDA--DKAEKLKQSLPPSLSISDV 71 >OCK98749.1 ribosomal protein L38e [Cenococcum geophilum 1.58] Length = 81 Score = 61.2 bits (147), Expect = 7e-10 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRCHRYLYTL+LKD ++KA+K+KQSLPP L + ++ Sbjct: 34 IKFKVRCHRYLYTLVLKD--SDKAEKLKQSLPPGLTITDV 71 >OCK77239.1 ribosomal protein L38e [Lepidopterella palustris CBS 459.81] Length = 81 Score = 61.2 bits (147), Expect = 7e-10 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRCHRYLYTL+LKD ++KA+K+KQSLPP L + ++ Sbjct: 34 IKFKVRCHRYLYTLVLKD--SDKAEKLKQSLPPGLTITDV 71 >XP_752041.1 60S ribosomal protein L38 [Aspergillus fumigatus Af293] EAL90003.1 60S ribosomal protein L38, putative [Aspergillus fumigatus Af293] EDP50163.1 60S ribosomal subunit Rpl38, putative [Aspergillus fumigatus A1163] KEY76047.1 60S ribosomal protein L38 [Aspergillus fumigatus var. RP-2014] KMK54529.1 60S ribosomal protein L38 [Aspergillus fumigatus Z5] Length = 80 Score = 60.8 bits (146), Expect = 1e-09 Identities = 27/40 (67%), Positives = 37/40 (92%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRCHR++YTL+LKD ++KADK+KQSLPP+L+V ++ Sbjct: 34 IKFKVRCHRFIYTLVLKD--SDKADKLKQSLPPALKVVDV 71 >XP_001267237.1 60S ribosomal protein L38 [Aspergillus fischeri NRRL 181] EAW25340.1 60S ribosomal protein L38, putative [Aspergillus fischeri NRRL 181] GAQ07945.1 60S ribosomal protein L38 [Aspergillus lentulus] Length = 80 Score = 60.8 bits (146), Expect = 1e-09 Identities = 27/40 (67%), Positives = 37/40 (92%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRCHR++YTL+LKD ++KADK+KQSLPP+L+V ++ Sbjct: 34 IKFKVRCHRFIYTLVLKD--SDKADKLKQSLPPALKVVDV 71 >KZZ95667.1 60S ribosomal protein L38 [Ascosphaera apis ARSEF 7405] Length = 125 Score = 62.0 bits (149), Expect = 1e-09 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRC R+LYTL+L+D T+KADK+KQSLPPSL++ E+ Sbjct: 79 IKFKVRCERFLYTLVLRD--TDKADKLKQSLPPSLKITEV 116 >OIW30258.1 ribosomal protein L38e [Coniochaeta ligniaria NRRL 30616] Length = 82 Score = 60.8 bits (146), Expect = 1e-09 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRC R+LYTL+LKD ++KA+K+KQSLPPSLQ+ E+ Sbjct: 34 IKFKVRCQRHLYTLVLKD--SDKAEKLKQSLPPSLQIKEL 71 >XP_018701667.1 Ribosomal protein L38e [Isaria fumosorosea ARSEF 2679] OAA56400.1 Ribosomal protein L38e [Isaria fumosorosea ARSEF 2679] Length = 75 Score = 60.5 bits (145), Expect = 1e-09 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRC ++LYTL+LKD TEKA+K+KQSLPP+LQ+ ++ Sbjct: 34 IKFKVRCQKHLYTLVLKD--TEKAEKLKQSLPPTLQITDV 71 >KEY68031.1 hypothetical protein S7711_06944 [Stachybotrys chartarum IBT 7711] KFA46505.1 hypothetical protein S40293_04209 [Stachybotrys chartarum IBT 40293] KFA62903.1 hypothetical protein S40285_02273 [Stachybotrys chlorohalonata IBT 40285] KFA72451.1 hypothetical protein S40288_08361 [Stachybotrys chartarum IBT 40288] Length = 75 Score = 60.5 bits (145), Expect = 1e-09 Identities = 26/40 (65%), Positives = 37/40 (92%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 +KFKVRC ++LYTL+LKD T+KA+K+KQSLPP+LQ++E+ Sbjct: 34 VKFKVRCQKHLYTLVLKD--TDKAEKLKQSLPPNLQISEV 71 >XP_008601140.1 ribosomal protein L38e [Beauveria bassiana ARSEF 2860] EJP63221.1 ribosomal protein L38e [Beauveria bassiana ARSEF 2860] Length = 76 Score = 60.5 bits (145), Expect = 1e-09 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRC ++LYTL+LKD TEKA+K+KQSLPP+LQ+ ++ Sbjct: 34 IKFKVRCQKHLYTLVLKD--TEKAEKLKQSLPPTLQITDV 71 >OAA69287.1 Ribosomal protein L38e [Cordyceps confragosa RCEF 1005] OAQ96716.1 hypothetical protein LLEC1_06355 [Cordyceps confragosa] Length = 77 Score = 60.5 bits (145), Expect = 1e-09 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRC ++LYTL+LKD TEKA+K+KQSLPP+LQ+ ++ Sbjct: 34 IKFKVRCQKHLYTLVLKD--TEKAEKLKQSLPPTLQITDV 71 >XP_001229025.1 60S ribosomal protein L38 [Chaetomium globosum CBS 148.51] EAQ90574.1 hypothetical protein CHGG_02509 [Chaetomium globosum CBS 148.51] Length = 80 Score = 60.5 bits (145), Expect = 1e-09 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRC R+LYTL+LKD +EKA+K+KQSLPP+LQ+ ++ Sbjct: 34 IKFKVRCQRFLYTLVLKD--SEKAEKLKQSLPPNLQIKDV 71 >XP_003661488.1 hypothetical protein MYCTH_79440 [Thermothelomyces thermophila ATCC 42464] AEO56243.1 hypothetical protein MYCTH_79440 [Thermothelomyces thermophila ATCC 42464] Length = 80 Score = 60.5 bits (145), Expect = 1e-09 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRC R+LYTL+LKD +EKA+K+KQSLPP+LQ+ ++ Sbjct: 34 IKFKVRCQRFLYTLVLKD--SEKAEKLKQSLPPNLQIKDV 71 >XP_003649013.1 60S ribosomal protein L38 [Thielavia terrestris NRRL 8126] AEO62677.1 hypothetical protein THITE_2169250 [Thielavia terrestris NRRL 8126] Length = 82 Score = 60.5 bits (145), Expect = 1e-09 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 IKFKVRC R+LYTL+LKD +EKA+K+KQSLPP+LQ+ ++ Sbjct: 34 IKFKVRCRRFLYTLVLKD--SEKAEKLKQSLPPNLQIKDV 71 >KND91978.1 60S ribosomal protein L38 [Tolypocladium ophioglossoides CBS 100239] Length = 75 Score = 60.1 bits (144), Expect = 2e-09 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = -1 Query: 410 IKFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 +KFKVRC ++LYTL+LKD TEKA+K+KQSLPP+LQ+ ++ Sbjct: 34 VKFKVRCQKHLYTLVLKD--TEKAEKLKQSLPPNLQITDV 71 >CRG88018.1 large subunit ribosomal protein L38e [Talaromyces islandicus] Length = 110 Score = 60.8 bits (146), Expect = 2e-09 Identities = 26/39 (66%), Positives = 36/39 (92%) Frame = -1 Query: 407 KFKVRCHRYLYTLILKDANTEKADKIKQSLPPSLQVNEI 291 KFKVRCHR+LYTL+LKD ++KADK+KQSLPP+L++ ++ Sbjct: 65 KFKVRCHRFLYTLVLKD--SDKADKLKQSLPPALKIEDV 101