BLASTX nr result
ID: Magnolia22_contig00032667
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00032667 (514 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003599577.1 hypothetical protein MTR_3g035650 [Medicago trunc... 60 2e-08 KMT05967.1 hypothetical protein BVRB_7g164560 [Beta vulgaris sub... 53 2e-06 >XP_003599577.1 hypothetical protein MTR_3g035650 [Medicago truncatula] AES69828.1 hypothetical protein MTR_3g035650 [Medicago truncatula] Length = 128 Score = 59.7 bits (143), Expect = 2e-08 Identities = 32/62 (51%), Positives = 36/62 (58%) Frame = +1 Query: 82 FMARRSFTSTHLCSIRLSPITENSPLLPLIRVWSCLSLIVVNHPFRSARDHHIDKLLSHK 261 FM RR FTST CS+RLSPI ENSPL V +HP A DH + KLL H+ Sbjct: 17 FMTRRPFTSTRHCSVRLSPIAENSPL-------------VADHPLGPATDHRLGKLLPHQ 63 Query: 262 LA 267 LA Sbjct: 64 LA 65 >KMT05967.1 hypothetical protein BVRB_7g164560 [Beta vulgaris subsp. vulgaris] Length = 61 Score = 52.8 bits (125), Expect = 2e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -2 Query: 180 PNSYER*QW*IFRNRRKPDGAKMGGGKRPTGHK 82 P+SY R QW IFRN RKPDGA GG+RPTGH+ Sbjct: 21 PDSYGRQQWGIFRNGRKPDGAMQRGGRRPTGHE 53