BLASTX nr result
ID: Magnolia22_contig00031945
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00031945 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ODQ69389.1 hypothetical protein LIPSTDRAFT_7040 [Lipomyces stark... 56 2e-07 KFY04666.1 hypothetical protein V491_09283 [Pseudogymnoascus sp.... 52 9e-06 >ODQ69389.1 hypothetical protein LIPSTDRAFT_7040 [Lipomyces starkeyi NRRL Y-11557] Length = 179 Score = 56.2 bits (134), Expect = 2e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = +3 Query: 222 ILIREAQPQDLSQVQQLGSNVFSTTFGHSVTPSQLNSYLTE 344 I IR A+PQD++ V +LG++VFS TFGHSV+P QL +YL+E Sbjct: 9 ISIRRARPQDVASVAELGAHVFSITFGHSVSPQQLQAYLSE 49 >KFY04666.1 hypothetical protein V491_09283 [Pseudogymnoascus sp. VKM F-3775] Length = 179 Score = 52.0 bits (123), Expect = 9e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +3 Query: 222 ILIREAQPQDLSQVQQLGSNVFSTTFGHSVTPSQLNSYLTE 344 I IR A P+D + V +LG++VFS TFGHSV P QL SYL E Sbjct: 9 INIRAASPKDAATVAKLGAHVFSVTFGHSVAPHQLQSYLDE 49