BLASTX nr result
ID: Magnolia22_contig00031468
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00031468 (391 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018174774.1 V-type proton ATPase proteolipid subunit [Purpure... 59 4e-08 EQL00698.1 ATPase, V0 complex, proteolipid subunit C [Ophiocordy... 57 5e-08 CRK45883.1 hypothetical protein BN1723_019813 [Verticillium long... 55 7e-08 XP_016259351.1 V-type proton ATPase proteolipid subunit, variant... 57 8e-08 OCT44352.1 V-type proton ATPase 16 kDa proteolipid subunit [Clad... 56 1e-07 OLN86365.1 V-type proton ATPase 16 kDa proteolipid subunit 2 [Co... 57 1e-07 KOM20720.1 hypothetical protein XA68_2371 [Ophiocordyceps unilat... 57 1e-07 KIV87022.1 V-type proton ATPase proteolipid subunit, variant [Ex... 57 1e-07 OAA72647.1 vacuolar ATP synthase 16 kDa proteolipid subunit [Cor... 57 2e-07 XP_013321562.1 V-type proton ATPase proteolipid subunit [Exophia... 57 2e-07 XP_016259350.1 V-type proton ATPase proteolipid subunit [Exophia... 57 2e-07 KIV87021.1 V-type proton ATPase proteolipid subunit [Exophiala s... 57 2e-07 XP_011107172.1 hypothetical protein H072_1180 [Dactylellina hapt... 56 3e-07 XP_007747272.1 V-type proton ATPase proteolipid subunit [Cladoph... 56 3e-07 XP_007760266.1 V-type proton ATPase proteolipid subunit [Cladoph... 56 3e-07 XP_001229170.1 vacuolar ATP synthase 16 kDa proteolipid subunit ... 56 3e-07 ODV97158.1 hypothetical protein PACTADRAFT_55485 [Pachysolen tan... 56 4e-07 KKY25124.1 putative vacuolar atp synthase 16 kda proteolipid sub... 56 4e-07 XP_016254697.1 V-type proton ATPase proteolipid subunit [Cladoph... 56 4e-07 XP_007591540.1 V-type proton ATPase proteolipid subunit [Colleto... 56 4e-07 >XP_018174774.1 V-type proton ATPase proteolipid subunit [Purpureocillium lilacinum] OAQ75301.1 V-type proton ATPase proteolipid subunit [Purpureocillium lilacinum] OAQ80930.1 V-type proton ATPase proteolipid subunit [Purpureocillium lilacinum] Length = 162 Score = 58.5 bits (140), Expect = 4e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTCN 294 ILILIFAEVLGLYGLIVALLMN+KAT +VTCN Sbjct: 131 ILILIFAEVLGLYGLIVALLMNSKATQNVTCN 162 >EQL00698.1 ATPase, V0 complex, proteolipid subunit C [Ophiocordyceps sinensis CO18] Length = 112 Score = 57.0 bits (136), Expect = 5e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTCN 294 ILILIFAEVLGLYGLIVALLMN+KAT + TCN Sbjct: 81 ILILIFAEVLGLYGLIVALLMNSKATLNATCN 112 >CRK45883.1 hypothetical protein BN1723_019813 [Verticillium longisporum] Length = 32 Score = 54.7 bits (130), Expect = 7e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KAT + TC Sbjct: 2 ILILIFAEVLGLYGLIVALLMNSKATLNTTC 32 >XP_016259351.1 V-type proton ATPase proteolipid subunit, variant [Exophiala oligosperma] KIW39135.1 V-type proton ATPase proteolipid subunit, variant [Exophiala oligosperma] Length = 117 Score = 56.6 bits (135), Expect = 8e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KA+T VTC Sbjct: 87 ILILIFAEVLGLYGLIVALLMNSKASTDVTC 117 >OCT44352.1 V-type proton ATPase 16 kDa proteolipid subunit [Cladophialophora carrionii] Length = 102 Score = 55.8 bits (133), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KA T VTC Sbjct: 72 ILILIFAEVLGLYGLIVALLMNSKAQTDVTC 102 >OLN86365.1 V-type proton ATPase 16 kDa proteolipid subunit 2 [Colletotrichum chlorophyti] Length = 162 Score = 57.0 bits (136), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTCN 294 ILILIFAEVLGLYGLIVALLMN+KAT V+CN Sbjct: 131 ILILIFAEVLGLYGLIVALLMNSKATVEVSCN 162 >KOM20720.1 hypothetical protein XA68_2371 [Ophiocordyceps unilateralis] Length = 162 Score = 57.0 bits (136), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTCN 294 ILILIFAEVLGLYGLIVALLMN+KAT + TCN Sbjct: 131 ILILIFAEVLGLYGLIVALLMNSKATLNATCN 162 >KIV87022.1 V-type proton ATPase proteolipid subunit, variant [Exophiala sideris] Length = 146 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KA+T VTC Sbjct: 116 ILILIFAEVLGLYGLIVALLMNSKASTDVTC 146 >OAA72647.1 vacuolar ATP synthase 16 kDa proteolipid subunit [Cordyceps confragosa RCEF 1005] OAQ97119.1 hypothetical protein LLEC1_03782 [Cordyceps confragosa] Length = 161 Score = 56.6 bits (135), Expect = 2e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KATT V+C Sbjct: 131 ILILIFAEVLGLYGLIVALLMNSKATTDVSC 161 >XP_013321562.1 V-type proton ATPase proteolipid subunit [Exophiala xenobiotica] KIW60978.1 V-type proton ATPase proteolipid subunit [Exophiala xenobiotica] Length = 161 Score = 56.6 bits (135), Expect = 2e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KA+T VTC Sbjct: 131 ILILIFAEVLGLYGLIVALLMNSKASTDVTC 161 >XP_016259350.1 V-type proton ATPase proteolipid subunit [Exophiala oligosperma] KIW39134.1 V-type proton ATPase proteolipid subunit [Exophiala oligosperma] Length = 161 Score = 56.6 bits (135), Expect = 2e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KA+T VTC Sbjct: 131 ILILIFAEVLGLYGLIVALLMNSKASTDVTC 161 >KIV87021.1 V-type proton ATPase proteolipid subunit [Exophiala sideris] Length = 161 Score = 56.6 bits (135), Expect = 2e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KA+T VTC Sbjct: 131 ILILIFAEVLGLYGLIVALLMNSKASTDVTC 161 >XP_011107172.1 hypothetical protein H072_1180 [Dactylellina haptotyla CBS 200.50] EPS44859.1 hypothetical protein H072_1180 [Dactylellina haptotyla CBS 200.50] Length = 162 Score = 56.2 bits (134), Expect = 3e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTCN 294 ILILIFAEVLGLYGLIVALLMN+KA S+TCN Sbjct: 131 ILILIFAEVLGLYGLIVALLMNSKAQESLTCN 162 >XP_007747272.1 V-type proton ATPase proteolipid subunit [Cladophialophora psammophila CBS 110553] XP_013285610.1 V-type proton ATPase proteolipid subunit [Fonsecaea pedrosoi CBS 271.37] XP_016636020.1 V-type proton ATPase proteolipid subunit [Fonsecaea multimorphosa CBS 102226] XP_016620905.1 V-type proton ATPase proteolipid subunit [Cladophialophora bantiana CBS 173.52] EXJ68706.1 V-type proton ATPase proteolipid subunit [Cladophialophora psammophila CBS 110553] KIW81802.1 V-type proton ATPase proteolipid subunit [Fonsecaea pedrosoi CBS 271.37] KIW94236.1 V-type proton ATPase proteolipid subunit [Cladophialophora bantiana CBS 173.52] KIY01898.1 V-type proton ATPase proteolipid subunit [Fonsecaea multimorphosa CBS 102226] OAL29581.1 V-type proton ATPase proteolipid subunit [Fonsecaea multimorphosa] OAL40550.1 V-type proton ATPase proteolipid subunit [Fonsecaea nubica] Length = 146 Score = 55.8 bits (133), Expect = 3e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KA T VTC Sbjct: 116 ILILIFAEVLGLYGLIVALLMNSKAQTDVTC 146 >XP_007760266.1 V-type proton ATPase proteolipid subunit [Cladophialophora yegresii CBS 114405] XP_008729586.1 V-type proton ATPase proteolipid subunit [Cladophialophora carrionii CBS 160.54] ETI20705.1 V-type proton ATPase proteolipid subunit [Cladophialophora carrionii CBS 160.54] EXJ55156.1 V-type proton ATPase proteolipid subunit [Cladophialophora yegresii CBS 114405] Length = 146 Score = 55.8 bits (133), Expect = 3e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KA T VTC Sbjct: 116 ILILIFAEVLGLYGLIVALLMNSKAQTDVTC 146 >XP_001229170.1 vacuolar ATP synthase 16 kDa proteolipid subunit [Chaetomium globosum CBS 148.51] EAQ90719.1 vacuolar ATP synthase 16 kDa proteolipid subunit [Chaetomium globosum CBS 148.51] Length = 147 Score = 55.8 bits (133), Expect = 3e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KAT ++TC Sbjct: 117 ILILIFAEVLGLYGLIVALLMNSKATLNITC 147 >ODV97158.1 hypothetical protein PACTADRAFT_55485 [Pachysolen tannophilus NRRL Y-2460] Length = 160 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALL+N++ATT VTC Sbjct: 130 ILILIFAEVLGLYGLIVALLLNSRATTDVTC 160 >KKY25124.1 putative vacuolar atp synthase 16 kda proteolipid subunit [Phaeomoniella chlamydospora] Length = 161 Score = 55.8 bits (133), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KATT V C Sbjct: 131 ILILIFAEVLGLYGLIVALLMNSKATTDVKC 161 >XP_016254697.1 V-type proton ATPase proteolipid subunit [Cladophialophora immunda] XP_018698356.1 V-type proton ATPase proteolipid subunit [Fonsecaea erecta] KIW34481.1 V-type proton ATPase proteolipid subunit [Cladophialophora immunda] OAG43237.1 V-type proton ATPase proteolipid subunit [Fonsecaea monophora] OAP64989.1 V-type proton ATPase proteolipid subunit [Fonsecaea erecta] Length = 161 Score = 55.8 bits (133), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KA T VTC Sbjct: 131 ILILIFAEVLGLYGLIVALLMNSKAQTDVTC 161 >XP_007591540.1 V-type proton ATPase proteolipid subunit [Colletotrichum fioriniae PJ7] EXF84855.1 V-type proton ATPase proteolipid subunit [Colletotrichum fioriniae PJ7] KXH25087.1 V-type proton ATPase proteolipid subunit [Colletotrichum simmondsii] KXH48987.1 V-type proton ATPase proteolipid subunit [Colletotrichum nymphaeae SA-01] KXH57717.1 V-type proton ATPase proteolipid subunit [Colletotrichum salicis] OHE97183.1 V-type proton ATPase proteolipid subunit [Colletotrichum orchidophilum] Length = 161 Score = 55.8 bits (133), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 389 ILILIFAEVLGLYGLIVALLMNAKATTSVTC 297 ILILIFAEVLGLYGLIVALLMN+KAT VTC Sbjct: 131 ILILIFAEVLGLYGLIVALLMNSKATQDVTC 161