BLASTX nr result
ID: Magnolia22_contig00031324
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00031324 (681 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008779274.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 2e-13 XP_010940571.2 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 77 1e-12 XP_008778703.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 5e-11 XP_010275661.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 4e-09 XP_018811520.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 7e-09 XP_012473689.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 1e-07 XP_017623794.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-07 XP_016700351.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-07 XP_016740980.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-07 XP_019417494.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 2e-06 XP_017973975.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 3e-06 EOY25154.1 Tetratricopeptide repeat-like superfamily protein, pu... 57 9e-06 >XP_008779274.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Phoenix dactylifera] XP_008779281.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Phoenix dactylifera] XP_008779286.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Phoenix dactylifera] XP_017696448.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Phoenix dactylifera] Length = 752 Score = 79.0 bits (193), Expect = 2e-13 Identities = 46/103 (44%), Positives = 57/103 (55%) Frame = -1 Query: 309 EP*SMSRKQLGCLPLVLLSKGRLFSAYSSASSVCLLDEQSFDQKQTLGTEIDDRSCGERL 130 EP SMSR QLG + LL K YSSASS+ L +Q F T + I RS + Sbjct: 16 EPYSMSRVQLGLVRRALLGKLPSLGLYSSASSLSCLHDQYFHPTPTTESTIAQRSITKSF 75 Query: 129 NPCIGRNHSLFPLVARVFHSLNWDTVREISFMKAAEKYGLSHS 1 + +GR +LFP VA V H+L+W E SF +A KYGL HS Sbjct: 76 DFYVGRGPTLFPFVAIVVHTLDWSIASETSFSEAVSKYGLGHS 118 >XP_010940571.2 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Elaeis guineensis] Length = 748 Score = 77.0 bits (188), Expect = 1e-12 Identities = 45/102 (44%), Positives = 57/102 (55%) Frame = -1 Query: 306 P*SMSRKQLGCLPLVLLSKGRLFSAYSSASSVCLLDEQSFDQKQTLGTEIDDRSCGERLN 127 P SMSR QLG + LL K YSSASS+ L +Q F T+ + RS + + Sbjct: 13 PYSMSRGQLGLIRRALLGKLPSLRLYSSASSLSCLHDQYFHPTPTIESTNASRSSTKGFD 72 Query: 126 PCIGRNHSLFPLVARVFHSLNWDTVREISFMKAAEKYGLSHS 1 +GR SLFP VA V H+L+W+ E SF +A KYGL HS Sbjct: 73 FYVGRGPSLFPFVAIVVHTLDWNVASETSFSEAVSKYGLDHS 114 >XP_008778703.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial-like [Phoenix dactylifera] XP_008778704.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial-like [Phoenix dactylifera] XP_008778706.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial-like [Phoenix dactylifera] XP_008778707.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial-like [Phoenix dactylifera] XP_017696392.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial-like [Phoenix dactylifera] XP_017696393.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial-like [Phoenix dactylifera] XP_017696394.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial-like [Phoenix dactylifera] XP_017696395.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial-like [Phoenix dactylifera] XP_017696396.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial-like [Phoenix dactylifera] Length = 720 Score = 72.0 bits (175), Expect = 5e-11 Identities = 42/99 (42%), Positives = 57/99 (57%) Frame = -1 Query: 297 MSRKQLGCLPLVLLSKGRLFSAYSSASSVCLLDEQSFDQKQTLGTEIDDRSCGERLNPCI 118 MSR LG L LL + R +S SS+SS+ LD+Q FD K + + R+ + LN Sbjct: 1 MSRFVLGLLRRALLGRTRSYS--SSSSSLLFLDDQLFDSKPAIEIDTVARTNVKGLNSYR 58 Query: 117 GRNHSLFPLVARVFHSLNWDTVREISFMKAAEKYGLSHS 1 ++ +LFP +A V H+LNW V E+ F A KYG SHS Sbjct: 59 DKHPTLFPFIAVVVHTLNWSIVTEVKFFGAVNKYGYSHS 97 >XP_010275661.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63400-like [Nelumbo nucifera] Length = 723 Score = 66.6 bits (161), Expect = 4e-09 Identities = 39/87 (44%), Positives = 46/87 (52%) Frame = -1 Query: 261 LLSKGRLFSAYSSASSVCLLDEQSFDQKQTLGTEIDDRSCGERLNPCIGRNHSLFPLVAR 82 LL + LF AYS ASS LL E +FD + D S N LFPLV R Sbjct: 14 LLRQRCLFRAYSGASSASLLYEHAFDSNFLFQNSVSDVSNVPGENSYATTECKLFPLVVR 73 Query: 81 VFHSLNWDTVREISFMKAAEKYGLSHS 1 VFHSL+W + REI F +A +KYG S Sbjct: 74 VFHSLSWRSAREIRFPEAVDKYGFHRS 100 >XP_018811520.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811521.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811522.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811523.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811524.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811525.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811526.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811527.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811529.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] Length = 749 Score = 65.9 bits (159), Expect = 7e-09 Identities = 36/82 (43%), Positives = 43/82 (52%) Frame = -1 Query: 246 RLFSAYSSASSVCLLDEQSFDQKQTLGTEIDDRSCGERLNPCIGRNHSLFPLVARVFHSL 67 RL AY +AS LL++ SFD+ + D R + I + LFPLV RVF SL Sbjct: 27 RLVRAYDAASLALLLEDHSFDESPKFENKKVDNVNVPRSSSSIQKRRKLFPLVGRVFKSL 86 Query: 66 NWDTVREISFMKAAEKYGLSHS 1 NW REI F A KYG HS Sbjct: 87 NWMVTREIRFSTAVRKYGFPHS 108 >XP_012473689.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] XP_012473690.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] XP_012473691.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] XP_012473692.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] XP_012473693.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] XP_012473694.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] XP_012473695.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] KJB22791.1 hypothetical protein B456_004G065800 [Gossypium raimondii] Length = 738 Score = 62.0 bits (149), Expect = 1e-07 Identities = 39/95 (41%), Positives = 51/95 (53%), Gaps = 6/95 (6%) Frame = -1 Query: 267 LVLLSKGRLFSAYSSASSVCLLDEQSFDQKQTLGTEIDDRSCGE------RLNPCIGRNH 106 +V+ K RL Y ++SS L+++ FD + E D+ GE R C RN Sbjct: 20 IVVHHKKRLLRVYYASSSALLMEDHDFDCIPKV--ESDNNEVGEVQVPEKRFKFC--RNP 75 Query: 105 SLFPLVARVFHSLNWDTVREISFMKAAEKYGLSHS 1 SLFP+V RVF SLNW R+ISF A + YG HS Sbjct: 76 SLFPIVVRVFKSLNWCAARKISFHNAVKMYGFDHS 110 >XP_017623794.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium arboreum] XP_017623795.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium arboreum] XP_017623796.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium arboreum] Length = 738 Score = 61.6 bits (148), Expect = 2e-07 Identities = 39/95 (41%), Positives = 51/95 (53%), Gaps = 6/95 (6%) Frame = -1 Query: 267 LVLLSKGRLFSAYSSASSVCLLDEQSFDQKQTLGTEIDDRSCGE------RLNPCIGRNH 106 +V+ K RL Y ++SS L+++ FD + E D+ GE R C RN Sbjct: 20 IVVHHKKRLLRVYYASSSALLMEDYDFDCIPKV--ESDNNEVGEFQVPEKRFKFC--RNP 75 Query: 105 SLFPLVARVFHSLNWDTVREISFMKAAEKYGLSHS 1 SLFP+V RVF SLNW R+ISF A + YG HS Sbjct: 76 SLFPIVVRVFKSLNWCAARKISFHNAVKMYGFDHS 110 >XP_016700351.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium hirsutum] XP_016700358.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium hirsutum] XP_016700365.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium hirsutum] XP_016700373.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium hirsutum] XP_016700378.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium hirsutum] Length = 738 Score = 61.6 bits (148), Expect = 2e-07 Identities = 39/95 (41%), Positives = 51/95 (53%), Gaps = 6/95 (6%) Frame = -1 Query: 267 LVLLSKGRLFSAYSSASSVCLLDEQSFDQKQTLGTEIDDRSCGE------RLNPCIGRNH 106 +V+ K RL Y ++SS L+++ FD + E D+ GE R C RN Sbjct: 20 IVVHHKKRLLRVYYASSSALLMEDYDFDCIPKV--ESDNNEVGEVQVPEKRFKFC--RNP 75 Query: 105 SLFPLVARVFHSLNWDTVREISFMKAAEKYGLSHS 1 SLFP+V RVF SLNW R+ISF A + YG HS Sbjct: 76 SLFPIVVRVFKSLNWCAARKISFHNAVKMYGFDHS 110 >XP_016740980.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Gossypium hirsutum] XP_016740987.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Gossypium hirsutum] Length = 738 Score = 61.6 bits (148), Expect = 2e-07 Identities = 39/95 (41%), Positives = 51/95 (53%), Gaps = 6/95 (6%) Frame = -1 Query: 267 LVLLSKGRLFSAYSSASSVCLLDEQSFDQKQTLGTEIDDRSCGE------RLNPCIGRNH 106 +V+ K RL Y ++SS L+++ FD + E D+ GE R C RN Sbjct: 20 IVVHHKKRLLRVYYASSSALLMEDYDFDCIAKV--ESDNNEVGEFQVPEKRFKFC--RNP 75 Query: 105 SLFPLVARVFHSLNWDTVREISFMKAAEKYGLSHS 1 SLFP+V RVF SLNW R+ISF A + YG HS Sbjct: 76 SLFPIVVRVFKSLNWCAARKISFHNAVKMYGFDHS 110 >XP_019417494.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] XP_019417495.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] XP_019417496.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] XP_019417497.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] Length = 744 Score = 58.5 bits (140), Expect = 2e-06 Identities = 39/95 (41%), Positives = 45/95 (47%), Gaps = 1/95 (1%) Frame = -1 Query: 282 LGCLPLVLLSKGR-LFSAYSSASSVCLLDEQSFDQKQTLGTEIDDRSCGERLNPCIGRNH 106 LG L L SK + F SSASS ++D FD+ LG+ G Sbjct: 16 LGLLQTNLNSKNQCFFRLCSSASSALMIDYHVFDESPKLGSNFVVNRTSAMFE---GTRR 72 Query: 105 SLFPLVARVFHSLNWDTVREISFMKAAEKYGLSHS 1 LFPLV RVF SLNW EI F E +GLSHS Sbjct: 73 ELFPLVVRVFKSLNWRVASEIRFGSWVESHGLSHS 107 >XP_017973975.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial [Theobroma cacao] XP_017973976.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial [Theobroma cacao] Length = 746 Score = 58.2 bits (139), Expect = 3e-06 Identities = 38/93 (40%), Positives = 50/93 (53%), Gaps = 4/93 (4%) Frame = -1 Query: 267 LVLLSKGRLFSAYSSASSVCLLDEQSFD---QKQTLGTEIDDRSCG-ERLNPCIGRNHSL 100 +V+ K L Y SASS LL++ FD + ++ E+++ +R C RN L Sbjct: 20 VVVHYKKFLLRVYYSASSALLLEDHVFDCSPEVVSVNNEVEELQVPRKRFEFC--RNPRL 77 Query: 99 FPLVARVFHSLNWDTVREISFMKAAEKYGLSHS 1 P V RVF SLNWD REI F AA+ YG HS Sbjct: 78 TPFVVRVFKSLNWDIAREIRFNMAAKMYGFDHS 110 >EOY25154.1 Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 746 Score = 56.6 bits (135), Expect = 9e-06 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 3/92 (3%) Frame = -1 Query: 267 LVLLSKGRLFSAYSSASSVCLLDEQSFD---QKQTLGTEIDDRSCGERLNPCIGRNHSLF 97 +V+ K L Y SASS LL++ FD + ++ E+++ + RN L Sbjct: 20 VVVHYKKCLLRVYYSASSALLLEDHVFDCSPEVVSVNNEVEELQVPRKTFEFC-RNPRLT 78 Query: 96 PLVARVFHSLNWDTVREISFMKAAEKYGLSHS 1 P V RVF SLNWD REI F AA+ YG HS Sbjct: 79 PFVVRVFKSLNWDIAREIRFNMAAKMYGFDHS 110