BLASTX nr result
ID: Magnolia22_contig00030283
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00030283 (445 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007925726.1 hypothetical protein MYCFIDRAFT_35895 [Pseudocerc... 117 8e-32 KXS96497.1 hypothetical protein AC578_6318 [Mycosphaerella eumusae] 116 1e-31 EME46595.1 hypothetical protein DOTSEDRAFT_70564 [Dothistroma se... 116 2e-31 KXT11039.1 hypothetical protein AC579_7316 [Pseudocercospora musae] 115 3e-31 XP_013431305.1 cytochrome-c oxidase, subunit VIIa [Aureobasidium... 114 6e-31 KEQ62206.1 cytochrome-c oxidase, subunit VIIa [Aureobasidium mel... 114 1e-30 XP_013341096.1 hypothetical protein AUEXF2481DRAFT_7417 [Aureoba... 112 5e-30 KEQ85764.1 cytochrome-c oxidase, subunit VIIa [Aureobasidium pul... 112 5e-30 XP_016762315.1 cytochrome-c oxidase, subunit VIIa [Sphaerulina m... 111 1e-29 XP_003857532.1 hypothetical protein MYCGRDRAFT_31400 [Zymoseptor... 108 1e-28 OCL10776.1 cytochrome c oxidase family protein-like protein [Glo... 103 2e-26 OCK90871.1 cytochrome c oxidase family protein-like protein [Cen... 101 9e-26 XP_007784837.1 hypothetical protein W97_08780 [Coniosporium apol... 101 1e-25 OCK75668.1 cytochrome c oxidase family protein-like protein [Lep... 100 3e-25 XP_018036689.1 cytochrome c oxidase family protein-like protein ... 100 4e-25 XP_018388375.1 cytochrome c oxidase family protein-like protein ... 100 5e-25 XP_008082075.1 hypothetical protein GLAREA_03631 [Glarea lozoyen... 98 2e-24 OAK99608.1 cytochrome-c oxidase, subunit VIIa [Stagonospora sp. ... 98 3e-24 KIV82913.1 hypothetical protein PV11_04979 [Exophiala sideris] 98 3e-24 XP_007692149.1 hypothetical protein COCMIDRAFT_106400 [Bipolaris... 98 3e-24 >XP_007925726.1 hypothetical protein MYCFIDRAFT_35895 [Pseudocercospora fijiensis CIRAD86] EME82685.1 hypothetical protein MYCFIDRAFT_35895 [Pseudocercospora fijiensis CIRAD86] Length = 63 Score = 117 bits (292), Expect = 8e-32 Identities = 54/59 (91%), Positives = 55/59 (93%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 VKPITGMLRRGLVLDLSVAFGLGTA GYFWWYGFH+PSIRRRD FYAKLEDERA A GQ Sbjct: 3 VKPITGMLRRGLVLDLSVAFGLGTACGYFWWYGFHVPSIRRRDLFYAKLEDERANAFGQ 61 >KXS96497.1 hypothetical protein AC578_6318 [Mycosphaerella eumusae] Length = 63 Score = 116 bits (291), Expect = 1e-31 Identities = 53/59 (89%), Positives = 55/59 (93%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 VKPITGMLRRGLVLDLSVAFGLGTA GYFWWYGFH+PS+RRRD FYAKLEDERA A GQ Sbjct: 3 VKPITGMLRRGLVLDLSVAFGLGTACGYFWWYGFHVPSVRRRDLFYAKLEDERANAFGQ 61 >EME46595.1 hypothetical protein DOTSEDRAFT_70564 [Dothistroma septosporum NZE10] Length = 62 Score = 116 bits (290), Expect = 2e-31 Identities = 52/59 (88%), Positives = 56/59 (94%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 +KPITGMLRRGLVLDLSVAFGLGT+ GYFWWYGFH+PS+RRRD FYAKLEDERA ALGQ Sbjct: 3 IKPITGMLRRGLVLDLSVAFGLGTSFGYFWWYGFHVPSVRRRDQFYAKLEDERASALGQ 61 >KXT11039.1 hypothetical protein AC579_7316 [Pseudocercospora musae] Length = 63 Score = 115 bits (288), Expect = 3e-31 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 VKPITGMLRRGLVLDLSVAFGLGTA GYFWWYGFH+P++RRRD FYAKLEDERA A GQ Sbjct: 3 VKPITGMLRRGLVLDLSVAFGLGTACGYFWWYGFHVPAVRRRDLFYAKLEDERANAFGQ 61 >XP_013431305.1 cytochrome-c oxidase, subunit VIIa [Aureobasidium namibiae CBS 147.97] KEQ76502.1 cytochrome-c oxidase, subunit VIIa [Aureobasidium namibiae CBS 147.97] Length = 62 Score = 114 bits (286), Expect = 6e-31 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 +KPITGMLRRGLVLDLSVAFGLGTASGY WWYGFH+P++RRRD FYAKLED+RA ALGQ Sbjct: 3 IKPITGMLRRGLVLDLSVAFGLGTASGYLWWYGFHVPAVRRRDLFYAKLEDQRAAALGQ 61 >KEQ62206.1 cytochrome-c oxidase, subunit VIIa [Aureobasidium melanogenum CBS 110374] Length = 62 Score = 114 bits (284), Expect = 1e-30 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 VKPITGMLRRGLVLDLSVAFGLGT++GY WWYGFH+P++RRRD FYAKLEDERA ALGQ Sbjct: 3 VKPITGMLRRGLVLDLSVAFGLGTSAGYLWWYGFHVPAVRRRDLFYAKLEDERAAALGQ 61 >XP_013341096.1 hypothetical protein AUEXF2481DRAFT_7417 [Aureobasidium subglaciale EXF-2481] KEQ92677.1 hypothetical protein AUEXF2481DRAFT_7417 [Aureobasidium subglaciale EXF-2481] Length = 62 Score = 112 bits (280), Expect = 5e-30 Identities = 49/59 (83%), Positives = 56/59 (94%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 +KPITGMLRRGLVLDLSVAFGLGT++GY WWYGFH+P++RRRD FYAKLEDERA +LGQ Sbjct: 3 IKPITGMLRRGLVLDLSVAFGLGTSAGYLWWYGFHVPAVRRRDLFYAKLEDERAASLGQ 61 >KEQ85764.1 cytochrome-c oxidase, subunit VIIa [Aureobasidium pullulans EXF-150] Length = 62 Score = 112 bits (280), Expect = 5e-30 Identities = 49/59 (83%), Positives = 56/59 (94%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 +KPITGMLRRGLVLDLSVAFGLGT++GY WWYGFH+P++RRRD FYAKLEDERA +LGQ Sbjct: 3 IKPITGMLRRGLVLDLSVAFGLGTSAGYLWWYGFHVPAVRRRDLFYAKLEDERAASLGQ 61 >XP_016762315.1 cytochrome-c oxidase, subunit VIIa [Sphaerulina musiva SO2202] EMF14194.1 cytochrome-c oxidase, subunit VIIa [Sphaerulina musiva SO2202] Length = 61 Score = 111 bits (278), Expect = 1e-29 Identities = 50/60 (83%), Positives = 54/60 (90%) Frame = -1 Query: 406 MVKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 MVKPITGMLRRGLVLDLSVAFGLGT+ GY WWYGFH+PS+RRRD FYAKLED+RA A Q Sbjct: 1 MVKPITGMLRRGLVLDLSVAFGLGTSFGYLWWYGFHVPSVRRRDVFYAKLEDQRANAFSQ 60 >XP_003857532.1 hypothetical protein MYCGRDRAFT_31400 [Zymoseptoria tritici IPO323] EGP92508.1 hypothetical protein MYCGRDRAFT_31400 [Zymoseptoria tritici IPO323] KJX98858.1 cytochrome c oxidase family protein [Zymoseptoria brevis] Length = 58 Score = 108 bits (270), Expect = 1e-28 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -1 Query: 406 MVKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQ 239 MVKPITGMLRRGLVLDLSVAFGLGTA GY WWYGFH+PS+RRRD FYAKLED+RA+ Sbjct: 1 MVKPITGMLRRGLVLDLSVAFGLGTAFGYGWWYGFHVPSVRRRDLFYAKLEDQRAE 56 >OCL10776.1 cytochrome c oxidase family protein-like protein [Glonium stellatum] Length = 63 Score = 103 bits (256), Expect = 2e-26 Identities = 44/59 (74%), Positives = 52/59 (88%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 VKPITGMLRRG+VLDL+VA GLGT +GY WWYG+H+P++R RD FY K+EDERA ALGQ Sbjct: 3 VKPITGMLRRGIVLDLTVALGLGTTAGYAWWYGYHVPAVRHRDAFYQKIEDERAAALGQ 61 >OCK90871.1 cytochrome c oxidase family protein-like protein [Cenococcum geophilum 1.58] Length = 63 Score = 101 bits (252), Expect = 9e-26 Identities = 43/59 (72%), Positives = 51/59 (86%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 VKPITGMLRRG+VLDL+VA GLGT +GY WWYG+H+P++R RD FY K+EDER ALGQ Sbjct: 3 VKPITGMLRRGIVLDLTVALGLGTTAGYAWWYGYHVPAVRHRDVFYQKIEDERVAALGQ 61 >XP_007784837.1 hypothetical protein W97_08780 [Coniosporium apollinis CBS 100218] EON69520.1 hypothetical protein W97_08780 [Coniosporium apollinis CBS 100218] Length = 62 Score = 101 bits (251), Expect = 1e-25 Identities = 42/58 (72%), Positives = 52/58 (89%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALG 230 +KPITGMLR+GLVLDLSVA GLG ++GYFWWYG+H+P++ RD FYAKLED+RA+ LG Sbjct: 3 IKPITGMLRKGLVLDLSVALGLGASAGYFWWYGYHVPAVHHRDLFYAKLEDQRAEDLG 60 >OCK75668.1 cytochrome c oxidase family protein-like protein [Lepidopterella palustris CBS 459.81] Length = 62 Score = 100 bits (249), Expect = 3e-25 Identities = 42/59 (71%), Positives = 52/59 (88%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 +KPITGM+RR +VLDLSVA GLGTA+GY WWYG+H+PS+R RD FY K+ED+RA ALG+ Sbjct: 3 IKPITGMIRRSVVLDLSVALGLGTAAGYAWWYGYHVPSVRHRDAFYQKIEDDRAAALGK 61 >XP_018036689.1 cytochrome c oxidase family protein-like protein [Paraphaeosphaeria sporulosa] OAG06324.1 cytochrome c oxidase family protein-like protein [Paraphaeosphaeria sporulosa] Length = 62 Score = 100 bits (248), Expect = 4e-25 Identities = 42/59 (71%), Positives = 52/59 (88%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 +KPITGMLRR +VLDLSVA GLG A+GY WWYG+H+P++R RD +Y ++EDERAQALGQ Sbjct: 3 IKPITGMLRRTIVLDLSVAMGLGVAAGYGWWYGYHVPAVRHRDAYYQRIEDERAQALGQ 61 >XP_018388375.1 cytochrome c oxidase family protein-like protein [Alternaria alternata] OAG22954.1 cytochrome c oxidase family protein-like protein [Alternaria alternata] Length = 62 Score = 99.8 bits (247), Expect = 5e-25 Identities = 44/59 (74%), Positives = 50/59 (84%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 VKPITGMLRR +VLDLSVA GLG +GY WWYG+H+P++R RD FY KLEDERA ALGQ Sbjct: 3 VKPITGMLRRQVVLDLSVAMGLGVTAGYGWWYGYHVPAVRHRDAFYQKLEDERASALGQ 61 >XP_008082075.1 hypothetical protein GLAREA_03631 [Glarea lozoyensis ATCC 20868] EPE30664.1 hypothetical protein GLAREA_03631 [Glarea lozoyensis ATCC 20868] Length = 61 Score = 98.2 bits (243), Expect = 2e-24 Identities = 42/54 (77%), Positives = 51/54 (94%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERA 242 +KPITGMLRRGLVLDLSVAFGLGT+ GY +WYG+H+P++RRRD FY+KLED+RA Sbjct: 3 IKPITGMLRRGLVLDLSVAFGLGTSFGYLFWYGYHVPAVRRRDLFYSKLEDQRA 56 >OAK99608.1 cytochrome-c oxidase, subunit VIIa [Stagonospora sp. SRC1lsM3a] Length = 62 Score = 97.8 bits (242), Expect = 3e-24 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 VKPITGMLRR +VLDLSVA GLG +GY WWYG+H+P++R RD FY KLEDERA LGQ Sbjct: 3 VKPITGMLRRQVVLDLSVAMGLGVVAGYGWWYGYHVPAVRHRDAFYQKLEDERAATLGQ 61 >KIV82913.1 hypothetical protein PV11_04979 [Exophiala sideris] Length = 62 Score = 97.8 bits (242), Expect = 3e-24 Identities = 41/58 (70%), Positives = 49/58 (84%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALG 230 +KPITGMLRRGLVLDLS+A GLGT GY WWYG+H+P +R RD FYA+LED+RA+ G Sbjct: 3 IKPITGMLRRGLVLDLSIAMGLGTTFGYLWWYGYHLPRVRARDNFYARLEDQRAKEAG 60 >XP_007692149.1 hypothetical protein COCMIDRAFT_106400 [Bipolaris oryzae ATCC 44560] XP_007703641.1 hypothetical protein COCSADRAFT_40220 [Bipolaris sorokiniana ND90Pr] XP_007712887.1 hypothetical protein COCCADRAFT_97720 [Bipolaris zeicola 26-R-13] XP_014083437.1 hypothetical protein COCC4DRAFT_30247 [Bipolaris maydis ATCC 48331] XP_014552954.1 hypothetical protein COCVIDRAFT_40921 [Bipolaris victoriae FI3] EMD60585.1 hypothetical protein COCSADRAFT_40220 [Bipolaris sorokiniana ND90Pr] EMD90258.1 hypothetical protein COCHEDRAFT_1022259 [Bipolaris maydis C5] ENI09528.1 hypothetical protein COCC4DRAFT_30247 [Bipolaris maydis ATCC 48331] EUC32779.1 hypothetical protein COCCADRAFT_97720 [Bipolaris zeicola 26-R-13] EUC41332.1 hypothetical protein COCMIDRAFT_106400 [Bipolaris oryzae ATCC 44560] EUN23372.1 hypothetical protein COCVIDRAFT_40921 [Bipolaris victoriae FI3] Length = 62 Score = 97.8 bits (242), Expect = 3e-24 Identities = 41/59 (69%), Positives = 50/59 (84%) Frame = -1 Query: 403 VKPITGMLRRGLVLDLSVAFGLGTASGYFWWYGFHIPSIRRRDTFYAKLEDERAQALGQ 227 +KPITGML+R +VLDLSVA G+G +GY WWYG+H+P++R RD FY KLEDERA ALGQ Sbjct: 3 IKPITGMLKRQIVLDLSVAMGIGVVAGYGWWYGYHVPAVRHRDAFYQKLEDERASALGQ 61