BLASTX nr result
ID: Magnolia22_contig00030139
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00030139 (487 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007676535.1 hypothetical protein BAUCODRAFT_476276 [Baudoinia... 60 6e-08 >XP_007676535.1 hypothetical protein BAUCODRAFT_476276 [Baudoinia panamericana UAMH 10762] EMC96480.1 hypothetical protein BAUCODRAFT_476276 [Baudoinia panamericana UAMH 10762] Length = 229 Score = 60.1 bits (144), Expect = 6e-08 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 485 AACSKDGIVYPGSGSGLGDTPFPSNDTSICQPAP 384 +ACSK GIVYPGSGSGLG TPF +NDTS+C +P Sbjct: 85 SACSKQGIVYPGSGSGLGSTPFSANDTSVCAASP 118