BLASTX nr result
ID: Magnolia22_contig00029476
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00029476 (418 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007281499.1 conidiation-specific protein 6 [Colletotrichum gl... 170 7e-53 EQB55394.1 conidiation protein 6 [Colletotrichum gloeosporioides... 169 2e-52 ENH81732.1 conidiation-specific protein 6 [Colletotrichum orbicu... 164 2e-50 KXH50410.1 conidiation protein 6 [Colletotrichum simmondsii] 164 3e-50 XP_007601880.1 conidiation protein 6 [Colletotrichum fioriniae P... 163 5e-50 KXH39018.1 conidiation protein 6 [Colletotrichum nymphaeae SA-01] 162 7e-50 KDN66303.1 putative conidiation protein 6 [Colletotrichum sublin... 162 1e-49 XP_008093002.1 conidiation protein 6 [Colletotrichum graminicola... 160 4e-49 KXH54212.1 conidiation protein 6 [Colletotrichum salicis] 159 2e-48 OLN93106.1 Conidiation-specific protein 6 [Colletotrichum chloro... 158 5e-48 KZL68589.1 conidiation protein 6 [Colletotrichum incanum] OHW937... 157 7e-48 XP_018155823.1 conidiation protein 6 [Colletotrichum higginsianu... 157 1e-47 KZL74614.1 conidiation-specific protein 6 [Colletotrichum tofiel... 157 1e-47 OHE97921.1 conidiation protein 6 [Colletotrichum orchidophilum] 155 6e-47 XP_018176786.1 conidiation protein 6 domain-containing protein [... 149 2e-44 XP_001912145.1 hypothetical protein [Podospora anserina S mat+] ... 146 2e-43 KJZ75583.1 hypothetical protein HIM_05046 [Hirsutella minnesoten... 146 2e-42 OAA32950.1 conidiation protein 6 [Aschersonia aleyrodis RCEF 2490] 138 3e-40 XP_007912346.1 putative conidiation-specific protein 6 protein [... 135 7e-39 XP_007833975.1 hypothetical protein PFICI_07203 [Pestalotiopsis ... 133 3e-38 >XP_007281499.1 conidiation-specific protein 6 [Colletotrichum gloeosporioides Nara gc5] ELA29444.1 conidiation-specific protein 6 [Colletotrichum gloeosporioides Nara gc5] Length = 83 Score = 170 bits (431), Expect = 7e-53 Identities = 83/83 (100%), Positives = 83/83 (100%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVSDEAKQSAKERLDNM Sbjct: 61 ATLKNPNVSDEAKQSAKERLDNM 83 >EQB55394.1 conidiation protein 6 [Colletotrichum gloeosporioides Cg-14] Length = 83 Score = 169 bits (428), Expect = 2e-52 Identities = 82/83 (98%), Positives = 83/83 (100%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPK+GDNEDKNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKAGDNEDKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVSDEAKQSAKERLDNM Sbjct: 61 ATLKNPNVSDEAKQSAKERLDNM 83 >ENH81732.1 conidiation-specific protein 6 [Colletotrichum orbiculare MAFF 240422] Length = 83 Score = 164 bits (415), Expect = 2e-50 Identities = 78/83 (93%), Positives = 82/83 (98%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPT+AQ+AGGHKANINNPNTSEESK+NSK VLENEFNGGDVPKSGDNE+KNPGNVAGGLK Sbjct: 1 MPTDAQVAGGHKANINNPNTSEESKQNSKTVLENEFNGGDVPKSGDNEEKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVSDEAKQSAKERLDNM Sbjct: 61 ATLKNPNVSDEAKQSAKERLDNM 83 >KXH50410.1 conidiation protein 6 [Colletotrichum simmondsii] Length = 83 Score = 164 bits (414), Expect = 3e-50 Identities = 78/83 (93%), Positives = 82/83 (98%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKANINNPNTSEESK+NSK +LENEFNGGDVPKSGDNE+KNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKQNSKKILENEFNGGDVPKSGDNEEKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVSDEAK+SAKERLDNM Sbjct: 61 ATLKNPNVSDEAKESAKERLDNM 83 >XP_007601880.1 conidiation protein 6 [Colletotrichum fioriniae PJ7] EXF74480.1 conidiation protein 6 [Colletotrichum fioriniae PJ7] Length = 83 Score = 163 bits (412), Expect = 5e-50 Identities = 78/83 (93%), Positives = 82/83 (98%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKANINNPNTSEESK+NSK VLENEFNGGDVPK+GDNE+KNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKQNSKKVLENEFNGGDVPKAGDNEEKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVSDEAK+SAKERLDNM Sbjct: 61 ATLKNPNVSDEAKESAKERLDNM 83 >KXH39018.1 conidiation protein 6 [Colletotrichum nymphaeae SA-01] Length = 83 Score = 162 bits (411), Expect = 7e-50 Identities = 77/83 (92%), Positives = 82/83 (98%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKANINNPNTSEESK+NSK +LENEFNGGDVPK+GDNE+KNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKQNSKKILENEFNGGDVPKAGDNEEKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVSDEAK+SAKERLDNM Sbjct: 61 ATLKNPNVSDEAKESAKERLDNM 83 >KDN66303.1 putative conidiation protein 6 [Colletotrichum sublineola] Length = 83 Score = 162 bits (409), Expect = 1e-49 Identities = 77/83 (92%), Positives = 81/83 (97%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKANINNPNTSEESK+NSK +LENEFNGGDVPK+GDNE KNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKQNSKKILENEFNGGDVPKAGDNEQKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVSDEAK+SAKERLDNM Sbjct: 61 ATLKNPNVSDEAKESAKERLDNM 83 >XP_008093002.1 conidiation protein 6 [Colletotrichum graminicola M1.001] EFQ28982.1 conidiation protein 6 [Colletotrichum graminicola M1.001] Length = 83 Score = 160 bits (406), Expect = 4e-49 Identities = 76/83 (91%), Positives = 81/83 (97%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKANINNPNTSEESK+NSK +LENEFNGGDVPK+GDN+ KNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKENSKKILENEFNGGDVPKAGDNDQKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVSDEAK+SAKERLDNM Sbjct: 61 ATLKNPNVSDEAKESAKERLDNM 83 >KXH54212.1 conidiation protein 6 [Colletotrichum salicis] Length = 83 Score = 159 bits (401), Expect = 2e-48 Identities = 75/83 (90%), Positives = 81/83 (97%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKANINNPNTSEESK+NSK +L+NEFNGGDVPK+GD+E KNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKQNSKKILDNEFNGGDVPKAGDDEQKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVSDEAK+SAKERLDNM Sbjct: 61 ATLKNPNVSDEAKESAKERLDNM 83 >OLN93106.1 Conidiation-specific protein 6 [Colletotrichum chlorophyti] Length = 83 Score = 158 bits (399), Expect = 5e-48 Identities = 76/83 (91%), Positives = 81/83 (97%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKANINNPNTSEESK++SK VLENEFNGGDVPK+GD+E KNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKQHSKEVLENEFNGGDVPKAGDDEQKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVS+EAKQSAKERLDNM Sbjct: 61 ATLKNPNVSEEAKQSAKERLDNM 83 >KZL68589.1 conidiation protein 6 [Colletotrichum incanum] OHW93716.1 conidiation protein 6 [Colletotrichum incanum] Length = 83 Score = 157 bits (398), Expect = 7e-48 Identities = 75/83 (90%), Positives = 80/83 (96%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKANINNPNTSEESK NSK +LENEFNGGDVPK+GD+E KNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKNNSKKILENEFNGGDVPKAGDDEQKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVSDEAK+SAKERL+NM Sbjct: 61 ATLKNPNVSDEAKESAKERLNNM 83 >XP_018155823.1 conidiation protein 6 [Colletotrichum higginsianum IMI 349063] OBR07305.1 conidiation protein 6 [Colletotrichum higginsianum IMI 349063] Length = 83 Score = 157 bits (396), Expect = 1e-47 Identities = 75/83 (90%), Positives = 80/83 (96%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKANINNPNTSEESK+NSK +LENEFNGGDV K+GD+E KNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKQNSKKILENEFNGGDVAKAGDDEQKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVSDEAK+SAKERLDNM Sbjct: 61 ATLKNPNVSDEAKESAKERLDNM 83 >KZL74614.1 conidiation-specific protein 6 [Colletotrichum tofieldiae] Length = 83 Score = 157 bits (396), Expect = 1e-47 Identities = 75/83 (90%), Positives = 80/83 (96%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKANINNPNTSEESK+NSK +LENEFNGGDV K+GD+E KNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKQNSKKILENEFNGGDVSKAGDDEQKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVSDEAK+SAKERLDNM Sbjct: 61 ATLKNPNVSDEAKESAKERLDNM 83 >OHE97921.1 conidiation protein 6 [Colletotrichum orchidophilum] Length = 83 Score = 155 bits (392), Expect = 6e-47 Identities = 74/83 (89%), Positives = 80/83 (96%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKANINNPN+SEESK+NSK +LENEFNGGDV K+GD+E KNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNSSEESKENSKKILENEFNGGDVAKAGDDEQKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVSDEAK+SAKERLDNM Sbjct: 61 ATLKNPNVSDEAKESAKERLDNM 83 >XP_018176786.1 conidiation protein 6 domain-containing protein [Purpureocillium lilacinum] OAQ77063.1 conidiation protein 6 domain-containing protein [Purpureocillium lilacinum] OAQ85929.1 conidiation protein 6 domain-containing protein [Purpureocillium lilacinum] Length = 83 Score = 149 bits (376), Expect = 2e-44 Identities = 69/83 (83%), Positives = 79/83 (95%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKA +NNPN S+E+K++S+ VL+NEFNGGDVPKSGDNE+KNPGNV GGLK Sbjct: 1 MPTEAQIAGGHKATLNNPNVSDEAKEHSRQVLDNEFNGGDVPKSGDNENKNPGNVVGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 ATLKNPNVS+EAK+SAKERLDNM Sbjct: 61 ATLKNPNVSEEAKESAKERLDNM 83 >XP_001912145.1 hypothetical protein [Podospora anserina S mat+] CAP73974.1 unnamed protein product [Podospora anserina S mat+] CDP26375.1 Putative Conidiation-specific protein [Podospora anserina S mat+] Length = 83 Score = 146 bits (369), Expect = 2e-43 Identities = 67/83 (80%), Positives = 79/83 (95%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPT+AQIAGGHKAN+NNPNTS+ESK NS+ +L+NEFNGGDVPK+ D +DKNPGNVAGGLK Sbjct: 1 MPTDAQIAGGHKANLNNPNTSKESKDNSQKILDNEFNGGDVPKASDTKDKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 AT+KNPNVSDEAK+SA+ERL+NM Sbjct: 61 ATMKNPNVSDEAKKSAEERLNNM 83 >KJZ75583.1 hypothetical protein HIM_05046 [Hirsutella minnesotensis 3608] Length = 157 Score = 146 bits (369), Expect = 2e-42 Identities = 68/84 (80%), Positives = 78/84 (92%) Frame = -3 Query: 338 NMPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGL 159 NMPTEAQIAGGHKA +NNPN S+ +K++SK VL+NEFNGG+VPK+GD DKNPGN+AGGL Sbjct: 74 NMPTEAQIAGGHKATLNNPNVSDGAKQHSKEVLDNEFNGGNVPKAGDGGDKNPGNIAGGL 133 Query: 158 KATLKNPNVSDEAKQSAKERLDNM 87 KATLKNPNVSDEAK+SAKERLDNM Sbjct: 134 KATLKNPNVSDEAKESAKERLDNM 157 >OAA32950.1 conidiation protein 6 [Aschersonia aleyrodis RCEF 2490] Length = 84 Score = 138 bits (348), Expect = 3e-40 Identities = 66/84 (78%), Positives = 77/84 (91%), Gaps = 1/84 (1%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNE-DKNPGNVAGGL 159 M T+AQ+AGGHKA +NNPN SEE+K+NS+ VL+NEFNGGDVPK+ DN+ +KNPGNVAGGL Sbjct: 1 MATDAQVAGGHKATLNNPNASEEAKQNSRQVLDNEFNGGDVPKASDNDGEKNPGNVAGGL 60 Query: 158 KATLKNPNVSDEAKQSAKERLDNM 87 KATLKNPNVSDEAKQSA+ERLD M Sbjct: 61 KATLKNPNVSDEAKQSAQERLDAM 84 >XP_007912346.1 putative conidiation-specific protein 6 protein [Phaeoacremonium minimum UCRPA7] EOO02891.1 putative conidiation-specific protein 6 protein [Phaeoacremonium minimum UCRPA7] Length = 83 Score = 135 bits (339), Expect = 7e-39 Identities = 63/81 (77%), Positives = 76/81 (93%) Frame = -3 Query: 329 TEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLKAT 150 T+AQIAGGHKAN+NNP+TS+ESK++SK VLE+++NGGDVP+S D+ DKNPGNVAGGLKAT Sbjct: 2 TDAQIAGGHKANLNNPHTSDESKEHSKKVLESDYNGGDVPRSTDSGDKNPGNVAGGLKAT 61 Query: 149 LKNPNVSDEAKQSAKERLDNM 87 LKNP VSDEAKQ+A+ERLD M Sbjct: 62 LKNPKVSDEAKQAAQERLDQM 82 >XP_007833975.1 hypothetical protein PFICI_07203 [Pestalotiopsis fici W106-1] ETS82201.1 hypothetical protein PFICI_07203 [Pestalotiopsis fici W106-1] Length = 84 Score = 133 bits (335), Expect = 3e-38 Identities = 63/83 (75%), Positives = 74/83 (89%) Frame = -3 Query: 335 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 156 MPTEAQIAGGHKAN+ N N+SEESK++S+ VL +EFNGGDVPK+ D +KNPGNVAGGLK Sbjct: 1 MPTEAQIAGGHKANLKNANSSEESKQHSRQVLNDEFNGGDVPKASDGGNKNPGNVAGGLK 60 Query: 155 ATLKNPNVSDEAKQSAKERLDNM 87 AT KNPNVS+EAKQSAK+RL+ M Sbjct: 61 ATTKNPNVSEEAKQSAKQRLEQM 83