BLASTX nr result
ID: Magnolia22_contig00029411
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00029411 (406 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008717781.1 hypothetical protein HMPREF1541_05218 [Cyphelloph... 54 7e-07 XP_006686080.1 NADH-ubiquinone oxidoreductase B12 subunit [[Cand... 52 1e-06 >XP_008717781.1 hypothetical protein HMPREF1541_05218 [Cyphellophora europaea CBS 101466] ETN40938.1 hypothetical protein HMPREF1541_05218 [Cyphellophora europaea CBS 101466] Length = 86 Score = 53.5 bits (127), Expect = 7e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -1 Query: 406 FTRWNRFKGAFPGFGIGLGAFLVYWALESTVLK 308 FTRWNRFKGAFPGFGI +GAF VY E K Sbjct: 41 FTRWNRFKGAFPGFGIAVGAFAVYLVAEQVFFK 73 >XP_006686080.1 NADH-ubiquinone oxidoreductase B12 subunit [[Candida] tenuis ATCC 10573] EGV63766.1 NADH-ubiquinone oxidoreductase B12 subunit [[Candida] tenuis ATCC 10573] Length = 54 Score = 52.0 bits (123), Expect = 1e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -1 Query: 406 FTRWNRFKGAFPGFGIGLGAFLVYWALESTVLKP 305 F+R+NRFKGAFPGFGIGL AF+VY E KP Sbjct: 18 FSRFNRFKGAFPGFGIGLAAFVVYVGYEKLTAKP 51