BLASTX nr result
ID: Magnolia22_contig00029047
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00029047 (469 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003666876.1 hypothetical protein MYCTH_2311970 [Thermothelomy... 55 9e-06 >XP_003666876.1 hypothetical protein MYCTH_2311970 [Thermothelomyces thermophila ATCC 42464] AEO61631.1 hypothetical protein MYCTH_2311970 [Thermothelomyces thermophila ATCC 42464] Length = 1257 Score = 54.7 bits (130), Expect = 9e-06 Identities = 39/107 (36%), Positives = 50/107 (46%), Gaps = 1/107 (0%) Frame = +3 Query: 3 PHHRQEYAHKTTSRAKEAYTPVAYRTDNHSVMPQNTASPTNYAAHAQFHPSMPYSTVPHS 182 P RQ A + TPV YR S+ P ++P YA A P+ S+ P++ Sbjct: 798 PAQRQGAAAPGARVSSRGPTPVGYRQPA-SIPPAAASNPNPYAPPAPIQPASATSSNPYA 856 Query: 183 QPQATFSAYSPTGHSP-PPNTTFHESQPRTARMAGNGHVYPPPPNAT 320 P AT S Y+P+G SP P F SQP A +G PPPP T Sbjct: 857 PPTAT-SQYAPSGASPYVPAAGFAPSQPVGAGYGPSGASVPPPPRNT 902