BLASTX nr result
ID: Magnolia22_contig00029002
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00029002 (486 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KIV82984.1 hypothetical protein PV11_05046 [Exophiala sideris] 55 5e-06 >KIV82984.1 hypothetical protein PV11_05046 [Exophiala sideris] Length = 686 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 481 QKEEHLNVFQKISQQKPKNYVFANTAPSDY 392 QKEEH N+ Q+++QQKPKNYVFANTAP DY Sbjct: 654 QKEEHANIAQQLAQQKPKNYVFANTAPQDY 683