BLASTX nr result
ID: Magnolia22_contig00027765
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00027765 (364 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010279018.1 PREDICTED: carboxyl-terminal-processing peptidase... 60 6e-08 >XP_010279018.1 PREDICTED: carboxyl-terminal-processing peptidase 3, chloroplastic isoform X1 [Nelumbo nucifera] Length = 535 Score = 59.7 bits (143), Expect = 6e-08 Identities = 30/55 (54%), Positives = 39/55 (70%) Frame = -2 Query: 228 FRTVGFTTNRWDGSRIKSVWRSIFSFAAAVAGVISIGCDSPRLAEFLTITSPISQ 64 F VGF + + S I+SV R+ FSFAAAVA V+SI CD+P LAE LT+ P+S+ Sbjct: 73 FEVVGFKKDESNRSLIRSVGRNFFSFAAAVAAVVSICCDTPALAESLTVAFPVSR 127