BLASTX nr result
ID: Magnolia22_contig00027583
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00027583 (432 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013270432.1 hypothetical protein Z518_06848 [Rhinocladiella m... 74 1e-12 XP_007759965.1 hypothetical protein A1O7_07779 [Cladophialophora... 73 2e-12 KUL91660.1 hypothetical protein ZTR_01079 [Talaromyces verruculo... 72 3e-12 KIW66056.1 hypothetical protein PV04_08263 [Capronia semi-immersa] 72 4e-12 KIV79726.1 hypothetical protein PV11_07272 [Exophiala sideris] 72 4e-12 CRG86413.1 hypothetical protein PISL3812_03419 [Talaromyces isla... 72 4e-12 XP_016633979.1 hypothetical protein Z520_04492 [Fonsecaea multim... 72 5e-12 OAL36328.1 hypothetical protein AYO20_04486 [Fonsecaea nubica] 72 5e-12 XP_013287995.1 hypothetical protein Z517_03436 [Fonsecaea pedros... 72 5e-12 XP_009154285.1 hypothetical protein HMPREF1120_02006 [Exophiala ... 71 1e-11 XP_002374758.1 RING finger domain protein [Aspergillus flavus NR... 71 1e-11 KOC18412.1 RING finger domain protein [Aspergillus flavus AF70] 71 1e-11 KJK64906.1 RINGv protein [Aspergillus parasiticus SU-1] 71 1e-11 XP_003189539.1 RING finger domain protein [Aspergillus oryzae RI... 71 1e-11 XP_007723972.1 hypothetical protein A1O1_04893 [Capronia coronat... 70 2e-11 GAM39608.1 hypothetical protein TCE0_034r11296 [Talaromyces cell... 70 2e-11 XP_016244059.1 hypothetical protein PV07_12012 [Cladophialophora... 70 2e-11 XP_002143670.1 RING finger domain protein [Talaromyces marneffei... 70 3e-11 KMU71741.1 hypothetical protein CISG_00051 [Coccidioides immitis... 69 3e-11 OCT47137.1 hypothetical protein CLCR_02456 [Cladophialophora car... 70 3e-11 >XP_013270432.1 hypothetical protein Z518_06848 [Rhinocladiella mackenziei CBS 650.93] KIX03296.1 hypothetical protein Z518_06848 [Rhinocladiella mackenziei CBS 650.93] Length = 442 Score = 73.6 bits (179), Expect = 1e-12 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEY 134 GRSV+GG F+ +KD LVLYCRW+LA+GH+KRR+MN+DK+ K+Y Sbjct: 397 GRSVLGGCLFVVLKDALVLYCRWKLAQGHRKRRIMNYDKRTKKY 440 >XP_007759965.1 hypothetical protein A1O7_07779 [Cladophialophora yegresii CBS 114405] EXJ57431.1 hypothetical protein A1O7_07779 [Cladophialophora yegresii CBS 114405] Length = 433 Score = 73.2 bits (178), Expect = 2e-12 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEY 134 GRSV+GG F+ +KD ++LYCRW+LA+GH++RR+MNFDKQ K+Y Sbjct: 388 GRSVVGGCLFVVLKDAIMLYCRWKLAQGHRQRRIMNFDKQTKKY 431 >KUL91660.1 hypothetical protein ZTR_01079 [Talaromyces verruculosus] Length = 303 Score = 72.0 bits (175), Expect = 3e-12 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEYV 137 GRSV+GG F+ +KD LVLYCRWRLA+ H+KRRV+N+D+QKK+ V Sbjct: 258 GRSVVGGCLFVLLKDALVLYCRWRLAQTHRKRRVLNYDRQKKKVV 302 >KIW66056.1 hypothetical protein PV04_08263 [Capronia semi-immersa] Length = 433 Score = 72.4 bits (176), Expect = 4e-12 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEY 134 GRSV+GG F+ +KD L+LYCRW+LA+GH++RR+MNFDK+ K+Y Sbjct: 388 GRSVVGGCLFVVLKDALMLYCRWKLAQGHRQRRIMNFDKRTKKY 431 >KIV79726.1 hypothetical protein PV11_07272 [Exophiala sideris] Length = 436 Score = 72.4 bits (176), Expect = 4e-12 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEY 134 GRSV+GG F+ +KD LVLYCRW+LA+GH+ RR+MNFDK+ K+Y Sbjct: 391 GRSVVGGCLFVVLKDALVLYCRWKLAQGHRLRRIMNFDKKTKKY 434 >CRG86413.1 hypothetical protein PISL3812_03419 [Talaromyces islandicus] Length = 518 Score = 72.4 bits (176), Expect = 4e-12 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEYV 137 GRSVIGG F+ +KD LVLYCRWRLA+ H+KRRV+N+D+QKK+ V Sbjct: 474 GRSVIGGCLFVLLKDALVLYCRWRLAQTHRKRRVLNYDRQKKKVV 518 >XP_016633979.1 hypothetical protein Z520_04492 [Fonsecaea multimorphosa CBS 102226] KIX99856.1 hypothetical protein Z520_04492 [Fonsecaea multimorphosa CBS 102226] Length = 446 Score = 72.0 bits (175), Expect = 5e-12 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEY 134 GRSV+GG F+ +KD L+LYCRW+LA+GH++RR+MNFDK+ K+Y Sbjct: 401 GRSVVGGCLFVVMKDALLLYCRWKLAQGHRQRRIMNFDKRLKKY 444 >OAL36328.1 hypothetical protein AYO20_04486 [Fonsecaea nubica] Length = 447 Score = 72.0 bits (175), Expect = 5e-12 Identities = 27/45 (60%), Positives = 40/45 (88%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEYV 137 GRSV+GG F+ +KD L+LYCRW+LA+GH++RR+MNFD++ K+Y+ Sbjct: 402 GRSVVGGCLFVVLKDALLLYCRWKLAQGHRQRRIMNFDRRTKQYL 446 >XP_013287995.1 hypothetical protein Z517_03436 [Fonsecaea pedrosoi CBS 271.37] KIW84187.1 hypothetical protein Z517_03436 [Fonsecaea pedrosoi CBS 271.37] Length = 447 Score = 72.0 bits (175), Expect = 5e-12 Identities = 27/45 (60%), Positives = 40/45 (88%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEYV 137 GRSV+GG F+ +KD L+LYCRW+LA+GH++RR+MNFD++ K+Y+ Sbjct: 402 GRSVVGGCLFVVLKDALLLYCRWKLAQGHRQRRIMNFDRRTKQYL 446 >XP_009154285.1 hypothetical protein HMPREF1120_02006 [Exophiala dermatitidis NIH/UT8656] EHY53824.1 hypothetical protein HMPREF1120_02006 [Exophiala dermatitidis NIH/UT8656] Length = 432 Score = 70.9 bits (172), Expect = 1e-11 Identities = 27/44 (61%), Positives = 38/44 (86%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEY 134 GRSV+GG F+ +KD LVLYCRW+LA+GH++RR++N+DK+ K Y Sbjct: 387 GRSVVGGCLFVVLKDALVLYCRWKLAQGHRQRRILNYDKKTKRY 430 >XP_002374758.1 RING finger domain protein [Aspergillus flavus NRRL3357] EED55976.1 RING finger domain protein [Aspergillus flavus NRRL3357] Length = 456 Score = 70.9 bits (172), Expect = 1e-11 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEYV 137 GRSV+GG AF+ +KD LVLYCRW+LA+ H++RRV+N+DK KK+ V Sbjct: 409 GRSVVGGCAFVLLKDALVLYCRWKLAQTHRRRRVLNYDKAKKQVV 453 >KOC18412.1 RING finger domain protein [Aspergillus flavus AF70] Length = 474 Score = 70.9 bits (172), Expect = 1e-11 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEYV 137 GRSV+GG AF+ +KD LVLYCRW+LA+ H++RRV+N+DK KK+ V Sbjct: 427 GRSVVGGCAFVLLKDALVLYCRWKLAQTHRRRRVLNYDKAKKQVV 471 >KJK64906.1 RINGv protein [Aspergillus parasiticus SU-1] Length = 474 Score = 70.9 bits (172), Expect = 1e-11 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEYV 137 GRSV+GG AF+ +KD LVLYCRW+LA+ H++RRV+N+DK KK+ V Sbjct: 427 GRSVVGGCAFVLLKDALVLYCRWKLAQTHRRRRVLNYDKAKKQVV 471 >XP_003189539.1 RING finger domain protein [Aspergillus oryzae RIB40] Length = 474 Score = 70.9 bits (172), Expect = 1e-11 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEYV 137 GRSV+GG AF+ +KD LVLYCRW+LA+ H++RRV+N+DK KK+ V Sbjct: 427 GRSVVGGCAFVLLKDALVLYCRWKLAQTHRRRRVLNYDKAKKQVV 471 >XP_007723972.1 hypothetical protein A1O1_04893 [Capronia coronata CBS 617.96] EXJ87966.1 hypothetical protein A1O1_04893 [Capronia coronata CBS 617.96] Length = 440 Score = 70.5 bits (171), Expect = 2e-11 Identities = 27/45 (60%), Positives = 39/45 (86%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEYV 137 GRSV+GG F+ +KD LVLYCRW+LA+GH++RR+M++DK+ K Y+ Sbjct: 395 GRSVVGGCLFVVLKDALVLYCRWKLAQGHRQRRIMDYDKKTKRYL 439 >GAM39608.1 hypothetical protein TCE0_034r11296 [Talaromyces cellulolyticus] Length = 515 Score = 70.5 bits (171), Expect = 2e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKK 128 GRSV+GG F+ +KD LVLYCRWRLA+ H+KRRV+N+D+QKK Sbjct: 471 GRSVVGGCLFVLLKDALVLYCRWRLAQTHRKRRVLNYDRQKK 512 >XP_016244059.1 hypothetical protein PV07_12012 [Cladophialophora immunda] KIW23843.1 hypothetical protein PV07_12012 [Cladophialophora immunda] Length = 445 Score = 70.1 bits (170), Expect = 2e-11 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEY 134 GRSV+GG F+ KD L+LYCRW+LA+GH++RR+MNFDK K Y Sbjct: 400 GRSVVGGCLFVVFKDALLLYCRWKLAQGHRQRRIMNFDKSTKMY 443 >XP_002143670.1 RING finger domain protein [Talaromyces marneffei ATCC 18224] EEA27155.1 RING finger domain protein [Talaromyces marneffei ATCC 18224] Length = 513 Score = 70.1 bits (170), Expect = 3e-11 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEYV 137 GRSV+GG F+ +KD LVLYCRWRLA+ H+KRRV+++D+QKK+ V Sbjct: 468 GRSVVGGCLFVLLKDALVLYCRWRLAQTHRKRRVLDYDRQKKKVV 512 >KMU71741.1 hypothetical protein CISG_00051 [Coccidioides immitis RMSCC 3703] Length = 234 Score = 68.6 bits (166), Expect = 3e-11 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEYV 137 GRS++GG F+ +KD LVLYCRW+LA+ H+KRRV+N+D+ KK V Sbjct: 188 GRSIVGGCLFVLLKDALVLYCRWKLAQSHRKRRVLNYDRTKKRVV 232 >OCT47137.1 hypothetical protein CLCR_02456 [Cladophialophora carrionii] Length = 434 Score = 69.7 bits (169), Expect = 3e-11 Identities = 26/44 (59%), Positives = 38/44 (86%) Frame = +3 Query: 3 GRSVIGGLAFIAVKDMLVLYCRWRLAEGHKKRRVMNFDKQKKEY 134 GRSV+GG F+ +KD ++LYCRW+LA+ H++RR+MNFDK+ K+Y Sbjct: 389 GRSVVGGCLFVVLKDAIMLYCRWKLAQSHRQRRIMNFDKETKKY 432