BLASTX nr result
ID: Magnolia22_contig00027426
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00027426 (503 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU47424.1 hypothetical protein TSUD_46360 [Trifolium subterraneum] 96 2e-22 CAA06832.1 DYW10 protein, partial [Arabidopsis thaliana] 95 3e-22 XP_017183653.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 2e-21 JAU23710.1 Pentatricopeptide repeat-containing protein, mitochon... 93 2e-21 AEX11740.1 hypothetical protein 0_16763_01, partial [Pinus taeda... 93 2e-21 AEX11731.1 hypothetical protein 0_16763_01, partial [Pinus taeda... 93 2e-21 AEX11730.1 hypothetical protein 0_16763_01, partial [Pinus taeda... 93 2e-21 OEL30286.1 Pentatricopeptide repeat-containing protein DWY1, chl... 95 3e-21 CBI39641.3 unnamed protein product, partial [Vitis vinifera] 96 4e-21 JAU39130.1 Pentatricopeptide repeat-containing protein, mitochon... 93 4e-21 KQK86934.1 hypothetical protein SETIT_036793mg [Setaria italica] 97 4e-21 XP_020168871.1 uncharacterized protein LOC109754374 [Aegilops ta... 97 5e-21 EMT08191.1 hypothetical protein F775_03044 [Aegilops tauschii] 97 5e-21 XP_004981638.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 5e-21 EAY88598.1 hypothetical protein OsI_10074 [Oryza sativa Indica G... 96 6e-21 XP_015630894.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 6e-21 XP_006650653.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 6e-21 EMS45170.1 hypothetical protein TRIUR3_26201 [Triticum urartu] 96 6e-21 XP_010247713.1 PREDICTED: pentatricopeptide repeat-containing pr... 98 9e-21 XP_009349226.1 PREDICTED: pentatricopeptide repeat-containing pr... 98 9e-21 >GAU47424.1 hypothetical protein TSUD_46360 [Trifolium subterraneum] Length = 144 Score = 96.3 bits (238), Expect = 2e-22 Identities = 42/53 (79%), Positives = 45/53 (84%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G+PIR+ KNLRICGDCHSAIK I+ I REIIVRD HRFHRFKDG CSC DYW Sbjct: 92 GVPIRITKNLRICGDCHSAIKFISRIVGREIIVRDNHRFHRFKDGCCSCKDYW 144 >CAA06832.1 DYW10 protein, partial [Arabidopsis thaliana] Length = 105 Score = 94.7 bits (234), Expect = 3e-22 Identities = 41/53 (77%), Positives = 44/53 (83%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G PI+V KNLRICGDCH AIK I++IE REIIVRD RFH FKDG CSCGDYW Sbjct: 53 GSPIQVFKNLRICGDCHKAIKFISEIEKREIIVRDTTRFHHFKDGSCSCGDYW 105 >XP_017183653.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09410-like isoform X1 [Malus domestica] Length = 247 Score = 96.7 bits (239), Expect = 2e-21 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 GMPIRV+KNL++CGDCHSAIKLIA + REI++RD +RFH FKDG CSCGDYW Sbjct: 195 GMPIRVMKNLQVCGDCHSAIKLIAKVTQREIVLRDANRFHHFKDGVCSCGDYW 247 >JAU23710.1 Pentatricopeptide repeat-containing protein, mitochondrial, partial [Noccaea caerulescens] Length = 118 Score = 92.8 bits (229), Expect = 2e-21 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G PI+V KNLRICGDCH AIK I++IE REI+VRD RFH FKDG CSCGDYW Sbjct: 66 GSPIQVFKNLRICGDCHKAIKFISEIERREILVRDTTRFHHFKDGFCSCGDYW 118 >AEX11740.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11743.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11745.1 hypothetical protein 0_16763_01, partial [Pinus taeda] Length = 119 Score = 92.8 bits (229), Expect = 2e-21 Identities = 36/53 (67%), Positives = 47/53 (88%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G P+R++KNLR+CGDCHSA+K I++I REI++RD +RFHRF+DG CSCGDYW Sbjct: 67 GTPLRIIKNLRVCGDCHSAMKYISNIAEREIVMRDANRFHRFRDGLCSCGDYW 119 >AEX11731.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11733.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11734.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11735.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11737.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11739.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11742.1 hypothetical protein 0_16763_01, partial [Pinus taeda] Length = 119 Score = 92.8 bits (229), Expect = 2e-21 Identities = 36/53 (67%), Positives = 47/53 (88%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G P+R++KNLR+CGDCHSA+K I++I REI++RD +RFHRF+DG CSCGDYW Sbjct: 67 GTPLRIIKNLRVCGDCHSAMKYISNIAEREIVMRDANRFHRFRDGLCSCGDYW 119 >AEX11730.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11732.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11738.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11741.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11744.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11746.1 hypothetical protein 0_16763_01, partial [Pinus taeda] AEX11747.1 hypothetical protein 0_16763_01, partial [Pinus radiata] Length = 119 Score = 92.8 bits (229), Expect = 2e-21 Identities = 36/53 (67%), Positives = 47/53 (88%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G P+R++KNLR+CGDCHSA+K I++I REI++RD +RFHRF+DG CSCGDYW Sbjct: 67 GTPLRIIKNLRVCGDCHSAMKYISNIAEREIVMRDANRFHRFRDGLCSCGDYW 119 >OEL30286.1 Pentatricopeptide repeat-containing protein DWY1, chloroplastic [Dichanthelium oligosanthes] Length = 204 Score = 95.1 bits (235), Expect = 3e-21 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G P+RV+KNLRICGDCH+A+KLIA + REI+VRD RFH FKDG CSCGDYW Sbjct: 152 GTPLRVMKNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHFKDGVCSCGDYW 204 >CBI39641.3 unnamed protein product, partial [Vitis vinifera] Length = 251 Score = 95.9 bits (237), Expect = 4e-21 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 GMPIRV+KNLR+CGDCHSAIKLIA I REII+RD +RFH FKDG CSC DYW Sbjct: 199 GMPIRVMKNLRVCGDCHSAIKLIAKITGREIILRDANRFHHFKDGFCSCRDYW 251 >JAU39130.1 Pentatricopeptide repeat-containing protein, mitochondrial, partial [Noccaea caerulescens] Length = 141 Score = 92.8 bits (229), Expect = 4e-21 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G PI+V KNLRICGDCH AIK I++IE REI+VRD RFH FKDG CSCGDYW Sbjct: 89 GSPIQVFKNLRICGDCHKAIKFISEIERREILVRDTTRFHHFKDGFCSCGDYW 141 >KQK86934.1 hypothetical protein SETIT_036793mg [Setaria italica] Length = 302 Score = 96.7 bits (239), Expect = 4e-21 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G P+RV+KNLRICGDCH+A+KLIA + REI+VRD RFH FKDG+CSCGDYW Sbjct: 250 GTPLRVMKNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHFKDGDCSCGDYW 302 >XP_020168871.1 uncharacterized protein LOC109754374 [Aegilops tauschii subsp. tauschii] Length = 307 Score = 96.7 bits (239), Expect = 5e-21 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G P+RV+KNLRICGDCHSA+KLIA + REIIVRD RFH FKDG CSCGDYW Sbjct: 255 GTPLRVMKNLRICGDCHSAVKLIAKVTGREIIVRDNKRFHHFKDGGCSCGDYW 307 >EMT08191.1 hypothetical protein F775_03044 [Aegilops tauschii] Length = 307 Score = 96.7 bits (239), Expect = 5e-21 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G P+RV+KNLRICGDCHSA+KLIA + REIIVRD RFH FKDG CSCGDYW Sbjct: 255 GTPLRVMKNLRICGDCHSAVKLIAKVTGREIIVRDNKRFHHFKDGGCSCGDYW 307 >XP_004981638.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial [Setaria italica] Length = 311 Score = 96.7 bits (239), Expect = 5e-21 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G P+RV+KNLRICGDCH+A+KLIA + REI+VRD RFH FKDG+CSCGDYW Sbjct: 259 GTPLRVMKNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHFKDGDCSCGDYW 311 >EAY88598.1 hypothetical protein OsI_10074 [Oryza sativa Indica Group] Length = 296 Score = 96.3 bits (238), Expect = 6e-21 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G P+RV+KNLRICGDCH+A+KLIA + REI+VRD RFH FKDG CSCGDYW Sbjct: 244 GTPLRVIKNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHFKDGACSCGDYW 296 >XP_015630894.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46460, mitochondrial [Oryza sativa Japonica Group] AAP50943.1 hypothetical protein [Oryza sativa Japonica Group] AAR87337.1 hypothetical protein [Oryza sativa Japonica Group] ABF99063.1 expressed protein [Oryza sativa Japonica Group] BAF13303.1 Os03g0767700 [Oryza sativa Japonica Group] EAZ28706.1 hypothetical protein OsJ_12720 [Oryza sativa Japonica Group] BAG93534.1 unnamed protein product [Oryza sativa Japonica Group] BAS86569.1 Os03g0767700 [Oryza sativa Japonica Group] Length = 296 Score = 96.3 bits (238), Expect = 6e-21 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G P+RV+KNLRICGDCH+A+KLIA + REI+VRD RFH FKDG CSCGDYW Sbjct: 244 GTPLRVIKNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHFKDGACSCGDYW 296 >XP_006650653.1 PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial [Oryza brachyantha] Length = 297 Score = 96.3 bits (238), Expect = 6e-21 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G P+RV+KNLRICGDCH+A+KLIA + REI+VRD RFH FKDG CSCGDYW Sbjct: 245 GTPLRVIKNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHFKDGACSCGDYW 297 >EMS45170.1 hypothetical protein TRIUR3_26201 [Triticum urartu] Length = 284 Score = 95.9 bits (237), Expect = 6e-21 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G P+RV+KNLRICGDCH+A+KLIA + REIIVRD RFH FKDG CSCGDYW Sbjct: 232 GTPLRVMKNLRICGDCHTAVKLIAKVTGREIIVRDNKRFHHFKDGACSCGDYW 284 >XP_010247713.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Nelumbo nucifera] Length = 694 Score = 98.2 bits (243), Expect = 9e-21 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 G+PIR+VKNLRIC DCHSAIKLIA IE REI+VRDR+RFH FK+G+CSC DYW Sbjct: 642 GIPIRIVKNLRICRDCHSAIKLIAQIEGREIVVRDRNRFHHFKEGKCSCRDYW 694 >XP_009349226.1 PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Pyrus x bretschneideri] Length = 703 Score = 98.2 bits (243), Expect = 9e-21 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = +1 Query: 1 GMPIRVVKNLRICGDCHSAIKLIADIEAREIIVRDRHRFHRFKDGECSCGDYW 159 GMPIRV+KNLR+CGDCHSAIKLIA + REI++RD +RFH FKDG CSCGDYW Sbjct: 651 GMPIRVMKNLRVCGDCHSAIKLIAKVTQREIVLRDANRFHHFKDGVCSCGDYW 703