BLASTX nr result
ID: Magnolia22_contig00027397
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00027397 (484 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013259616.1 MFS transporter, DHA1 family, multidrug resistanc... 61 7e-08 >XP_013259616.1 MFS transporter, DHA1 family, multidrug resistance protein [Exophiala aquamarina CBS 119918] KEF57026.1 MFS transporter, DHA1 family, multidrug resistance protein [Exophiala aquamarina CBS 119918] Length = 654 Score = 60.8 bits (146), Expect = 7e-08 Identities = 40/93 (43%), Positives = 51/93 (54%), Gaps = 11/93 (11%) Frame = -2 Query: 483 LVPIPVLFMLYGEKLRARSKFG------GPAVDSE---EDEDHSVALHATKSRAMSEAGT 331 LVPIPVLF LYG KLRA+SKF PA + E +DE ALHAT+SRA + T Sbjct: 560 LVPIPVLFYLYGAKLRAKSKFAPTMAIKKPADEEESSSDDEMQMAALHATRSRAHHDLNT 619 Query: 330 GLMAARTKSKVE--DEDNATMAGTNSSGPDLEK 238 G RT++ +AT+ N++ EK Sbjct: 620 GRSRTRTRTNASAGAVPSATIPSNNTNSAGAEK 652