BLASTX nr result
ID: Magnolia22_contig00026798
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00026798 (532 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016269019.1 hypothetical protein PV06_01366 [Exophiala oligos... 54 1e-06 XP_007722557.1 hypothetical protein A1O1_03462, partial [Caproni... 52 4e-06 XP_013269428.1 hypothetical protein Z518_08231 [Rhinocladiella m... 52 7e-06 XP_018693404.1 hypothetical protein AYL99_05039 [Fonsecaea erect... 52 7e-06 XP_016239779.1 hypothetical protein PV08_00136 [Exophiala spinif... 52 8e-06 >XP_016269019.1 hypothetical protein PV06_01366 [Exophiala oligosperma] KIW48803.1 hypothetical protein PV06_01366 [Exophiala oligosperma] Length = 89 Score = 53.9 bits (128), Expect = 1e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +1 Query: 250 VSGASQGLGNTTKAVGDTTSGYITKTTGKQQNAQNPLGL 366 V GA++GLGNTTKAVGDT G GK+Q A+NPLGL Sbjct: 51 VGGATEGLGNTTKAVGDTAKGTTDSIGGKKQTAENPLGL 89 >XP_007722557.1 hypothetical protein A1O1_03462, partial [Capronia coronata CBS 617.96] EXJ90363.1 hypothetical protein A1O1_03462, partial [Capronia coronata CBS 617.96] Length = 56 Score = 52.0 bits (123), Expect = 4e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = +1 Query: 250 VSGASQGLGNTTKAVGDTTSGYITKTTGKQQNAQNPLGL 366 V GA++GLGNTTKAVGDT G GK+Q+ NPLGL Sbjct: 18 VGGATEGLGNTTKAVGDTARGATDSVGGKKQSGDNPLGL 56 >XP_013269428.1 hypothetical protein Z518_08231 [Rhinocladiella mackenziei CBS 650.93] KIX02292.1 hypothetical protein Z518_08231 [Rhinocladiella mackenziei CBS 650.93] Length = 86 Score = 52.0 bits (123), Expect = 7e-06 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = +1 Query: 256 GASQGLGNTTKAVGDTTSGYITKTTGKQQNAQNPLGL 366 GA++GLGNTTKAVG+TT G GK+Q+A NPLGL Sbjct: 50 GATEGLGNTTKAVGETTKGATDTIGGKKQDANNPLGL 86 >XP_018693404.1 hypothetical protein AYL99_05039 [Fonsecaea erecta] OAP60037.1 hypothetical protein AYL99_05039 [Fonsecaea erecta] Length = 87 Score = 52.0 bits (123), Expect = 7e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = +1 Query: 250 VSGASQGLGNTTKAVGDTTSGYITKTTGKQQNAQNPLGL 366 V GA+QGLG+TTKAVGDTT GK+Q A NPLGL Sbjct: 49 VGGATQGLGDTTKAVGDTTKSTTDSIGGKKQTADNPLGL 87 >XP_016239779.1 hypothetical protein PV08_00136 [Exophiala spinifera] KIW19563.1 hypothetical protein PV08_00136 [Exophiala spinifera] Length = 89 Score = 52.0 bits (123), Expect = 8e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +1 Query: 250 VSGASQGLGNTTKAVGDTTSGYITKTTGKQQNAQNPLGL 366 VSGA++GLGNTTKAVG+T K GK+Q A NPLGL Sbjct: 51 VSGATEGLGNTTKAVGNTAKDTTDKIGGKKQTADNPLGL 89