BLASTX nr result
ID: Magnolia22_contig00026756
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00026756 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EQL02859.1 Ribosomal protein S7e [Ophiocordyceps sinensis CO18] 86 2e-18 KKY18351.1 putative 40s ribosomal protein s7 [Phaeomoniella chla... 85 5e-18 KXH66331.1 40S ribosomal protein S7 [Colletotrichum salicis] 85 6e-18 XP_007591973.1 40S ribosomal protein S7 [Colletotrichum fiorinia... 85 6e-18 CZT49287.1 40S ribosomal protein CRPS-7 [Rhynchosporium secalis]... 84 8e-18 XP_013260842.1 40S ribosomal protein S7 [Exophiala aquamarina CB... 84 1e-17 XP_018075503.1 putative 40S ribosomal protein S7 [Phialocephala ... 84 2e-17 OLN83381.1 40S ribosomal protein S7 [Colletotrichum chlorophyti] 84 2e-17 XP_007834885.1 40S ribosomal protein S7 [Pestalotiopsis fici W10... 84 2e-17 XP_003016284.1 hypothetical protein ARB_05683 [Trichophyton benh... 82 2e-17 ENH87095.1 40s ribosomal protein s7 [Colletotrichum orbiculare M... 83 2e-17 OHE91963.1 40S ribosomal protein S7 [Colletotrichum orchidophilum] 83 2e-17 KZL64303.1 40s ribosomal protein s7 [Colletotrichum incanum] KZL... 83 2e-17 OAL55520.1 ribosomal protein S7e [Pyrenochaeta sp. DS3sAY3a] 83 3e-17 OCW40193.1 40S ribosomal protein S7 [Diaporthe helianthi] 83 3e-17 GAW22283.1 40S ribosomal protein S7 [fungal sp. No.14919] 82 4e-17 CZR66171.1 40S ribosomal protein CRPS-7 [Phialocephala subalpina] 82 4e-17 OCK74856.1 ribosomal protein S7e [Lepidopterella palustris CBS 4... 82 4e-17 XP_017998853.1 40S ribosomal protein S7 [Phialophora attae] KPI3... 82 4e-17 KLU87202.1 40S ribosomal protein S7 [Magnaporthiopsis poae ATCC ... 82 4e-17 >EQL02859.1 Ribosomal protein S7e [Ophiocordyceps sinensis CO18] Length = 203 Score = 85.9 bits (211), Expect = 2e-18 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SKLLKVVLDEKERGGVD+RLDTYSEVYRRLTGR V FEFP S+GAEY Sbjct: 157 SKLLKVVLDEKERGGVDYRLDTYSEVYRRLTGRNVNFEFPQSSGAEY 203 >KKY18351.1 putative 40s ribosomal protein s7 [Phaeomoniella chlamydospora] Length = 201 Score = 84.7 bits (208), Expect = 5e-18 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SKLLKV+LDEKERGGVD+RLDTYS+VYR+LTGR VAFEFPISA EY Sbjct: 155 SKLLKVILDEKERGGVDYRLDTYSDVYRKLTGRSVAFEFPISAQGEY 201 >KXH66331.1 40S ribosomal protein S7 [Colletotrichum salicis] Length = 202 Score = 84.7 bits (208), Expect = 6e-18 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SKLLKV+LDEKERGGVD+RLDTYSEVYR+LTGRGV FEFP S AEY Sbjct: 156 SKLLKVILDEKERGGVDYRLDTYSEVYRKLTGRGVTFEFPQSGSAEY 202 >XP_007591973.1 40S ribosomal protein S7 [Colletotrichum fioriniae PJ7] EXF84465.1 40S ribosomal protein S7 [Colletotrichum fioriniae PJ7] KXH34404.1 40S ribosomal protein S7 [Colletotrichum simmondsii] Length = 202 Score = 84.7 bits (208), Expect = 6e-18 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SKLLKV+LDEKERGGVD+RLDTYSEVYR+LTGRGV FEFP S AEY Sbjct: 156 SKLLKVILDEKERGGVDYRLDTYSEVYRKLTGRGVTFEFPQSGSAEY 202 >CZT49287.1 40S ribosomal protein CRPS-7 [Rhynchosporium secalis] CZS90121.1 40S ribosomal protein CRPS-7 [Rhynchosporium agropyri] CZS93296.1 40S ribosomal protein CRPS-7 [Rhynchosporium commune] Length = 201 Score = 84.3 bits (207), Expect = 8e-18 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SK+LKVVLDEKE+GGVDHRLDTYSEVYR+LTGRGV FEFP S AEY Sbjct: 155 SKVLKVVLDEKEKGGVDHRLDTYSEVYRKLTGRGVGFEFPQSGPAEY 201 >XP_013260842.1 40S ribosomal protein S7 [Exophiala aquamarina CBS 119918] KEF58252.1 40S ribosomal protein S7 [Exophiala aquamarina CBS 119918] Length = 203 Score = 84.0 bits (206), Expect = 1e-17 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SK+LKVVLDEKERGGVD+RLDTYSEVYR+LTGRGV FEFP+S A+Y Sbjct: 157 SKVLKVVLDEKERGGVDYRLDTYSEVYRKLTGRGVGFEFPLSGTADY 203 >XP_018075503.1 putative 40S ribosomal protein S7 [Phialocephala scopiformis] KUJ21148.1 putative 40S ribosomal protein S7 [Phialocephala scopiformis] Length = 201 Score = 83.6 bits (205), Expect = 2e-17 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SK+LKVVLDEKE+GGVDHRLDTYSEVY++LTGRGV FEFP S AEY Sbjct: 155 SKMLKVVLDEKEKGGVDHRLDTYSEVYKKLTGRGVGFEFPQSGTAEY 201 >OLN83381.1 40S ribosomal protein S7 [Colletotrichum chlorophyti] Length = 203 Score = 83.6 bits (205), Expect = 2e-17 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SK+LKV+LDEKERGGVD+RLDTYSEVYRRLTGRGV FEFP S EY Sbjct: 157 SKILKVILDEKERGGVDYRLDTYSEVYRRLTGRGVTFEFPQSGSTEY 203 >XP_007834885.1 40S ribosomal protein S7 [Pestalotiopsis fici W106-1] ETS80584.1 40S ribosomal protein S7 [Pestalotiopsis fici W106-1] Length = 203 Score = 83.6 bits (205), Expect = 2e-17 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 +KLLKVVLDEKERGGVD+RLDTYSEVYRRLTGRGV FEFP S EY Sbjct: 157 AKLLKVVLDEKERGGVDYRLDTYSEVYRRLTGRGVTFEFPQSGSTEY 203 >XP_003016284.1 hypothetical protein ARB_05683 [Trichophyton benhamiae CBS 112371] EFE35639.1 hypothetical protein ARB_05683 [Trichophyton benhamiae CBS 112371] Length = 138 Score = 81.6 bits (200), Expect = 2e-17 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SKLLKVVL EKERGGVDHRLD Y EVYR+LTGRGVAFEFP S +EY Sbjct: 92 SKLLKVVLHEKERGGVDHRLDAYGEVYRKLTGRGVAFEFPQSGSSEY 138 >ENH87095.1 40s ribosomal protein s7 [Colletotrichum orbiculare MAFF 240422] Length = 202 Score = 83.2 bits (204), Expect = 2e-17 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SK+LKV+LDEKERGGVD+RLDTYSEVYRRLTGRGV FEFP S EY Sbjct: 156 SKVLKVILDEKERGGVDYRLDTYSEVYRRLTGRGVTFEFPQSGSTEY 202 >OHE91963.1 40S ribosomal protein S7 [Colletotrichum orchidophilum] Length = 203 Score = 83.2 bits (204), Expect = 2e-17 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SKLLKV+LDEKERGGVD+RLDTYSEVYR+LTGRGV FEFP S EY Sbjct: 157 SKLLKVILDEKERGGVDYRLDTYSEVYRKLTGRGVTFEFPQSGSTEY 203 >KZL64303.1 40s ribosomal protein s7 [Colletotrichum incanum] KZL66314.1 40S ribosomal protein S7 [Colletotrichum tofieldiae] OHW92185.1 40s ribosomal protein s7 [Colletotrichum incanum] Length = 203 Score = 83.2 bits (204), Expect = 2e-17 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SKLLKV+LDEKERGGVD+RLDTYSEVYR+LTGRGV FEFP S EY Sbjct: 157 SKLLKVILDEKERGGVDYRLDTYSEVYRKLTGRGVTFEFPQSGATEY 203 >OAL55520.1 ribosomal protein S7e [Pyrenochaeta sp. DS3sAY3a] Length = 202 Score = 82.8 bits (203), Expect = 3e-17 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SK+LKVVLDEKERGGVD+RLDTYSEVY+RLTG+GV FEFP SA A+Y Sbjct: 156 SKILKVVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSAAADY 202 >OCW40193.1 40S ribosomal protein S7 [Diaporthe helianthi] Length = 203 Score = 82.8 bits (203), Expect = 3e-17 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SK LKV+LDEKERGGVD+RLDTYSEVYR+LTGRGV FEFP S G EY Sbjct: 157 SKNLKVILDEKERGGVDYRLDTYSEVYRKLTGRGVTFEFPQSTGTEY 203 >GAW22283.1 40S ribosomal protein S7 [fungal sp. No.14919] Length = 200 Score = 82.4 bits (202), Expect = 4e-17 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SKLLKV+LDEKERGGVD+RLDTYSEVYRRLTGR V FEFP S +EY Sbjct: 154 SKLLKVILDEKERGGVDYRLDTYSEVYRRLTGRSVTFEFPQSGSSEY 200 >CZR66171.1 40S ribosomal protein CRPS-7 [Phialocephala subalpina] Length = 201 Score = 82.4 bits (202), Expect = 4e-17 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SK+LKVVLDEKE+GGVDHRLDTYSEVY++LTGRGV FEFP S EY Sbjct: 155 SKVLKVVLDEKEKGGVDHRLDTYSEVYKKLTGRGVGFEFPQSGSTEY 201 >OCK74856.1 ribosomal protein S7e [Lepidopterella palustris CBS 459.81] Length = 203 Score = 82.4 bits (202), Expect = 4e-17 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SK+LK+VLDEKERGGVD+RLDTYSEVY+RLTG+GV FEFP SA +EY Sbjct: 157 SKILKIVLDEKERGGVDYRLDTYSEVYKRLTGKGVNFEFPQSAASEY 203 >XP_017998853.1 40S ribosomal protein S7 [Phialophora attae] KPI38890.1 40S ribosomal protein S7 [Phialophora attae] Length = 203 Score = 82.4 bits (202), Expect = 4e-17 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SK+LKVVLDEKERGGVD+RLDTY+EVYR+LTGR FEFP+S GAEY Sbjct: 157 SKVLKVVLDEKERGGVDYRLDTYAEVYRKLTGRVTGFEFPVSGGAEY 203 >KLU87202.1 40S ribosomal protein S7 [Magnaporthiopsis poae ATCC 64411] Length = 203 Score = 82.4 bits (202), Expect = 4e-17 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 2 SKLLKVVLDEKERGGVDHRLDTYSEVYRRLTGRGVAFEFPISAGAEY 142 SK+LKV+LDEKERGGVD+RLDTYSEVYRRLTGRGV FEFP + A+Y Sbjct: 157 SKVLKVILDEKERGGVDYRLDTYSEVYRRLTGRGVVFEFPQTGAADY 203