BLASTX nr result
ID: Magnolia22_contig00026590
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00026590 (516 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KKY36665.1 hypothetical protein UCDDA912_g03337 [Diaporthe ampel... 68 2e-10 KEQ60677.1 hypothetical protein M437DRAFT_26708, partial [Aureob... 67 2e-10 XP_003652551.1 hypothetical protein THITE_2114178 [Thielavia ter... 67 2e-10 KIM99915.1 hypothetical protein OIDMADRAFT_19819 [Oidiodendron m... 66 4e-10 XP_009856804.1 hypothetical protein NEUTE1DRAFT_150565 [Neurospo... 67 5e-10 XP_003351102.1 hypothetical protein SMAC_05981 [Sordaria macrosp... 67 7e-10 CCC08627.1 unnamed protein product [Sordaria macrospora k-hell] 67 7e-10 KEQ66807.1 hypothetical protein M437DRAFT_40211 [Aureobasidium m... 66 8e-10 XP_018388524.1 hypothetical protein CC77DRAFT_694001 [Alternaria... 66 1e-09 OCW43881.1 hypothetical protein DHEL01_05778 [Diaporthe helianthi] 64 1e-09 XP_013425140.1 hypothetical protein M436DRAFT_52268 [Aureobasidi... 66 1e-09 KHE89913.1 hypothetical protein GE21DRAFT_654 [Neurospora crassa] 66 1e-09 EGZ78027.1 hypothetical protein NEUTE2DRAFT_162733 [Neurospora t... 66 1e-09 XP_965083.2 hypothetical protein NCU10933 [Neurospora crassa OR7... 66 1e-09 XP_001912840.1 hypothetical protein [Podospora anserina S mat+] ... 64 4e-09 OCL14862.1 hypothetical protein AOQ84DRAFT_330342 [Glonium stell... 64 5e-09 ESZ96296.1 hypothetical protein SBOR_3351 [Sclerotinia borealis ... 63 8e-09 OJJ72354.1 hypothetical protein ASPBRDRAFT_124694 [Aspergillus b... 63 9e-09 KIM93133.1 hypothetical protein OIDMADRAFT_138380 [Oidiodendron ... 63 1e-08 KEQ79565.1 hypothetical protein M438DRAFT_283436 [Aureobasidium ... 63 1e-08 >KKY36665.1 hypothetical protein UCDDA912_g03337 [Diaporthe ampelina] Length = 295 Score = 68.2 bits (165), Expect = 2e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 375 SNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 ++VHLDGEET+SVPVFETCD VR+KI A+LKKPGVTQA Sbjct: 175 NSVHLDGEETDSVPVFETCDVVRRKITAHLKKPGVTQA 212 >KEQ60677.1 hypothetical protein M437DRAFT_26708, partial [Aureobasidium melanogenum CBS 110374] Length = 210 Score = 67.0 bits (162), Expect = 2e-10 Identities = 27/39 (69%), Positives = 38/39 (97%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 +S++HLDGE+T+SVPV++TCD++R++I AYLKKPGVTQA Sbjct: 94 LSDIHLDGEDTDSVPVYDTCDDIRRQIAAYLKKPGVTQA 132 >XP_003652551.1 hypothetical protein THITE_2114178 [Thielavia terrestris NRRL 8126] AEO66215.1 hypothetical protein THITE_2114178 [Thielavia terrestris NRRL 8126] Length = 197 Score = 66.6 bits (161), Expect = 2e-10 Identities = 36/70 (51%), Positives = 44/70 (62%) Frame = +3 Query: 279 EIAGVKMPQXXXXXXXXXXXXXXXXXXXXXXISNVHLDGEETNSVPVFETCDEVRKKINA 458 EIAGVK+P +S++ L GEE ++VPVFETCDE+RKKI+A Sbjct: 46 EIAGVKLPDKKKQKTAGSNPAAAAVD-----LSDIVLPGEEDDAVPVFETCDEIRKKISA 100 Query: 459 YLKKPGVTQA 488 YLKKPGVTQA Sbjct: 101 YLKKPGVTQA 110 >KIM99915.1 hypothetical protein OIDMADRAFT_19819 [Oidiodendron maius Zn] Length = 213 Score = 65.9 bits (159), Expect = 4e-10 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 +S+VHLDGE+T V V+ETCDEVRKK+NAYL++P VTQA Sbjct: 68 VSDVHLDGEDTEEVEVYETCDEVRKKVNAYLRQPNVTQA 106 >XP_009856804.1 hypothetical protein NEUTE1DRAFT_150565 [Neurospora tetrasperma FGSC 2508] EGO53184.1 hypothetical protein NEUTE1DRAFT_150565 [Neurospora tetrasperma FGSC 2508] Length = 347 Score = 67.0 bits (162), Expect = 5e-10 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 IS+V+L+GEET+ VPV+ETCDE+R+KI+AYLKKPGVT A Sbjct: 205 ISDVYLEGEETDDVPVYETCDEIRRKIDAYLKKPGVTMA 243 >XP_003351102.1 hypothetical protein SMAC_05981 [Sordaria macrospora k-hell] Length = 716 Score = 67.0 bits (162), Expect = 7e-10 Identities = 26/39 (66%), Positives = 38/39 (97%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 +S++HL+GEET+ VPV++TCDE+R+KI+AYL++PGVTQA Sbjct: 196 VSDIHLEGEETDEVPVYDTCDEIRRKIDAYLRRPGVTQA 234 >CCC08627.1 unnamed protein product [Sordaria macrospora k-hell] Length = 725 Score = 67.0 bits (162), Expect = 7e-10 Identities = 26/39 (66%), Positives = 38/39 (97%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 +S++HL+GEET+ VPV++TCDE+R+KI+AYL++PGVTQA Sbjct: 196 VSDIHLEGEETDEVPVYDTCDEIRRKIDAYLRRPGVTQA 234 >KEQ66807.1 hypothetical protein M437DRAFT_40211 [Aureobasidium melanogenum CBS 110374] Length = 304 Score = 66.2 bits (160), Expect = 8e-10 Identities = 35/90 (38%), Positives = 50/90 (55%) Frame = +3 Query: 219 MTVPSKKRKSTENAVPDQPAEIAGVKMPQXXXXXXXXXXXXXXXXXXXXXXISNVHLDGE 398 + +P+KK+K+ NA A +G K +N+HLDGE Sbjct: 126 LKIPTKKQKTAANAATSSAASSSGKK-------------------DAVTIDTTNIHLDGE 166 Query: 399 ETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 ET+SV V+++CDE+RKKI A+L+KPGVT A Sbjct: 167 ETDSVKVYDSCDEIRKKIAAHLRKPGVTAA 196 >XP_018388524.1 hypothetical protein CC77DRAFT_694001 [Alternaria alternata] OAG23103.1 hypothetical protein CC77DRAFT_694001 [Alternaria alternata] Length = 294 Score = 65.9 bits (159), Expect = 1e-09 Identities = 39/95 (41%), Positives = 52/95 (54%) Frame = +3 Query: 204 ELEKLMTVPSKKRKSTENAVPDQPAEIAGVKMPQXXXXXXXXXXXXXXXXXXXXXXISNV 383 E++ + T P+KK KS++ PAE V I ++ Sbjct: 121 EIQGIKTTPNKKAKSSQG-----PAEKDSVPS------------------------IDDI 151 Query: 384 HLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 LDGE+ + VPVF+TCD+VRKKINA+LKKPGVTQA Sbjct: 152 ELDGEKDDKVPVFDTCDDVRKKINAHLKKPGVTQA 186 >OCW43881.1 hypothetical protein DHEL01_05778 [Diaporthe helianthi] Length = 168 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 ++++HLDGEET+SVPV+ETCD VR+KI A+LK PG+TQA Sbjct: 26 LNSIHLDGEETDSVPVYETCDVVRRKITAHLKTPGLTQA 64 >XP_013425140.1 hypothetical protein M436DRAFT_52268 [Aureobasidium namibiae CBS 147.97] KEQ70910.1 hypothetical protein M436DRAFT_52268 [Aureobasidium namibiae CBS 147.97] Length = 311 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 ISN+HLDGEET+SV V++TCDEVRKKI+AYL+KP T A Sbjct: 163 ISNIHLDGEETDSVQVYDTCDEVRKKISAYLRKPNTTAA 201 >KHE89913.1 hypothetical protein GE21DRAFT_654 [Neurospora crassa] Length = 349 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 IS+V+L+GEET+ VPV++TCDE+R+KI+AYLKKPGVT A Sbjct: 207 ISDVYLEGEETDDVPVYDTCDEIRRKIDAYLKKPGVTMA 245 >EGZ78027.1 hypothetical protein NEUTE2DRAFT_162733 [Neurospora tetrasperma FGSC 2509] Length = 349 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 IS+V+L+GEET+ VPV++TCDE+R+KI+AYLKKPGVT A Sbjct: 207 ISDVYLEGEETDDVPVYDTCDEIRRKIDAYLKKPGVTMA 245 >XP_965083.2 hypothetical protein NCU10933 [Neurospora crassa OR74A] CAE76397.1 hypothetical protein [Neurospora crassa] EAA35847.2 hypothetical protein NCU10933 [Neurospora crassa OR74A] Length = 349 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 IS+V+L+GEET+ VPV++TCDE+R+KI+AYLKKPGVT A Sbjct: 207 ISDVYLEGEETDDVPVYDTCDEIRRKIDAYLKKPGVTMA 245 >XP_001912840.1 hypothetical protein [Podospora anserina S mat+] CAP60322.1 unnamed protein product [Podospora anserina S mat+] CDP22960.1 Putative protein of unknown function [Podospora anserina S mat+] Length = 333 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 IS +HL+GEET+SVPV+++CDE+R+KIN +LKK GVTQA Sbjct: 185 ISGIHLEGEETDSVPVYDSCDEIRRKINLHLKKDGVTQA 223 >OCL14862.1 hypothetical protein AOQ84DRAFT_330342 [Glonium stellatum] Length = 255 Score = 63.5 bits (153), Expect = 5e-09 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 +S++HL+GEE + VPV+ETCD +R+KI+ YLKKPGVTQA Sbjct: 99 VSDIHLEGEEEDKVPVYETCDMIRRKIDQYLKKPGVTQA 137 >ESZ96296.1 hypothetical protein SBOR_3351 [Sclerotinia borealis F-4128] Length = 240 Score = 62.8 bits (151), Expect = 8e-09 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 +S + LDGE T SVPV+++CDEVRKKI+AYL++PGVTQA Sbjct: 152 VSEIKLDGESTASVPVYDSCDEVRKKISAYLREPGVTQA 190 >OJJ72354.1 hypothetical protein ASPBRDRAFT_124694 [Aspergillus brasiliensis CBS 101740] Length = 278 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 +S++HLDGEE +VP+F+TCD VR+KI A+L+KPGVTQA Sbjct: 137 LSDIHLDGEEDGNVPIFDTCDVVRRKIRAHLRKPGVTQA 175 >KIM93133.1 hypothetical protein OIDMADRAFT_138380 [Oidiodendron maius Zn] Length = 253 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 IS ++L+GEE SVPV+++CDE+RKKI AYL+KPGVTQA Sbjct: 111 ISRIYLEGEEDLSVPVYDSCDEIRKKIGAYLRKPGVTQA 149 >KEQ79565.1 hypothetical protein M438DRAFT_283436 [Aureobasidium pullulans EXF-150] Length = 303 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = +3 Query: 372 ISNVHLDGEETNSVPVFETCDEVRKKINAYLKKPGVTQA 488 IS+VHL+GE+ +SV V+++CDE+RKKINAYL+KPGVT A Sbjct: 159 ISSVHLEGEDDDSVEVYDSCDEIRKKINAYLRKPGVTAA 197