BLASTX nr result
ID: Magnolia22_contig00025472
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00025472 (605 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_001806136.1 hypothetical protein SNOG_16005 [Parastagonospora... 72 1e-13 XP_003840158.1 hypothetical protein LEMA_P109440.1 [Leptosphaeri... 62 5e-10 XP_018249717.1 hypothetical protein FOXG_20544 [Fusarium oxyspor... 61 2e-09 OAL46348.1 hypothetical protein IQ07DRAFT_590512 [Pyrenochaeta s... 59 1e-08 KFH43929.1 hypothetical protein ACRE_053060 [Acremonium chrysoge... 57 5e-08 XP_009226536.1 hypothetical protein GGTG_10399 [Gaeumannomyces t... 56 1e-06 XP_018379380.1 hypothetical protein CC77DRAFT_1026206 [Alternari... 52 3e-06 >XP_001806136.1 hypothetical protein SNOG_16005 [Parastagonospora nodorum SN15] EAT76584.1 hypothetical protein SNOG_16005 [Parastagonospora nodorum SN15] Length = 41 Score = 71.6 bits (174), Expect = 1e-13 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 132 MPLLWTKNWGGKHAGGGVTVDRHGARRNPFRFSCGKFSCFR 254 M L+W K +GG+HAGGGV DRHG RR PFR SCG+FSCFR Sbjct: 1 MGLMWHKGFGGRHAGGGVVADRHGVRRAPFRLSCGRFSCFR 41 >XP_003840158.1 hypothetical protein LEMA_P109440.1 [Leptosphaeria maculans JN3] CBX96679.1 hypothetical protein LEMA_P109440.1 [Leptosphaeria maculans JN3] Length = 41 Score = 62.4 bits (150), Expect = 5e-10 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +3 Query: 132 MPLLWTKNWGGKHAGGGVTVDRHGARRNPFRFSCGKFSCFR 254 M L+W K +GG+HAGGG+ D+HG RR P R SC FSCFR Sbjct: 1 MGLMWHKGFGGRHAGGGIVADKHGIRRAPIRLSCFGFSCFR 41 >XP_018249717.1 hypothetical protein FOXG_20544 [Fusarium oxysporum f. sp. lycopersici 4287] XP_018757512.1 hypothetical protein FVEG_16784 [Fusarium verticillioides 7600] EWG51321.1 hypothetical protein FVEG_16784 [Fusarium verticillioides 7600] EWY85261.1 hypothetical protein FOYG_12499 [Fusarium oxysporum FOSC 3-a] EWZ35712.1 hypothetical protein FOZG_11578 [Fusarium oxysporum Fo47] EWZ96292.1 hypothetical protein FOWG_03707 [Fusarium oxysporum f. sp. lycopersici MN25] EXA37840.1 hypothetical protein FOVG_11928 [Fusarium oxysporum f. sp. pisi HDV247] EXK30141.1 hypothetical protein FOMG_13780 [Fusarium oxysporum f. sp. melonis 26406] EXK90269.1 hypothetical protein FOQG_07096 [Fusarium oxysporum f. sp. raphani 54005] EXL55250.1 hypothetical protein FOCG_05914 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] EXL81768.1 hypothetical protein FOPG_05108 [Fusarium oxysporum f. sp. conglutinans race 2 54008] EXM05656.1 hypothetical protein FOIG_04172 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] EXM27212.1 hypothetical protein FOTG_06566 [Fusarium oxysporum f. sp. vasinfectum 25433] KNB11672.1 hypothetical protein FOXG_20544 [Fusarium oxysporum f. sp. lycopersici 4287] Length = 42 Score = 60.8 bits (146), Expect = 2e-09 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +3 Query: 132 MPLLWTKNWGGKHAGGGVTVDRHGARRNPFRFSCGKFSCFR 254 M L W+K GG+H G V VD+HG RR P+RFS GKFSCFR Sbjct: 1 MGLFWSKGVGGRHFGTSVHVDKHGVRRGPWRFSLGKFSCFR 41 >OAL46348.1 hypothetical protein IQ07DRAFT_590512 [Pyrenochaeta sp. DS3sAY3a] Length = 61 Score = 59.3 bits (142), Expect = 1e-08 Identities = 29/61 (47%), Positives = 33/61 (54%), Gaps = 20/61 (32%) Frame = +3 Query: 132 MPLLWTKNWGGKHAG--------------------GGVTVDRHGARRNPFRFSCGKFSCF 251 M L+WTK +GG+HAG GGV DRHG RR P R SCG+FSCF Sbjct: 1 MGLMWTKMFGGRHAGKLIPPEQCSYDCSKLTLNLGGGVVADRHGVRRAPMRISCGRFSCF 60 Query: 252 R 254 R Sbjct: 61 R 61 >KFH43929.1 hypothetical protein ACRE_053060 [Acremonium chrysogenum ATCC 11550] Length = 43 Score = 57.0 bits (136), Expect = 5e-08 Identities = 25/41 (60%), Positives = 28/41 (68%) Frame = +3 Query: 132 MPLLWTKNWGGKHAGGGVTVDRHGARRNPFRFSCGKFSCFR 254 M L W K G +H G V VDRHG RR P+RFS GK+SCFR Sbjct: 1 MGLFWGKGIGTRHFGTSVRVDRHGVRRGPWRFSLGKYSCFR 41 >XP_009226536.1 hypothetical protein GGTG_10399 [Gaeumannomyces tritici R3-111a-1] EJT71139.1 hypothetical protein GGTG_10399 [Gaeumannomyces tritici R3-111a-1] Length = 151 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = +3 Query: 132 MPLLWTKNWGGKHAGGGVTVDRHGARRNPFRFSCGKFSCFR 254 MP ++K +GG+H G V DRHG RR P+RFS G+F+CF+ Sbjct: 108 MPFFYSKAFGGRHFGTSVHADRHGVRRGPWRFSLGRFNCFK 148 >XP_018379380.1 hypothetical protein CC77DRAFT_1026206 [Alternaria alternata] OAG13959.1 hypothetical protein CC77DRAFT_1026206 [Alternaria alternata] Length = 51 Score = 52.4 bits (124), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 174 GGGVTVDRHGARRNPFRFSCGKFSCFR 254 GGGV DRHG RR PFR SCG+FSCFR Sbjct: 25 GGGVVADRHGVRRAPFRISCGRFSCFR 51