BLASTX nr result
ID: Magnolia22_contig00025313
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00025313 (363 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008731163.1 ribosomal protein S18 [Cladophialophora carrionii... 52 7e-06 >XP_008731163.1 ribosomal protein S18 [Cladophialophora carrionii CBS 160.54] ETI20595.1 ribosomal protein S18 [Cladophialophora carrionii CBS 160.54] Length = 127 Score = 51.6 bits (122), Expect = 7e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 1 RRAIALGLMPSVHRHPEVLRLETYSRIQNSG 93 RRAIALGLMPSVHRHPE+L+ E +R+ NSG Sbjct: 94 RRAIALGLMPSVHRHPEILKKEISTRLSNSG 124