BLASTX nr result
ID: Magnolia22_contig00024897
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00024897 (335 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP57096.1 hypothetical protein BN969_27950 [Staphylococcus aure... 51 2e-06 >CDP57096.1 hypothetical protein BN969_27950 [Staphylococcus aureus subsp. aureus] Length = 57 Score = 50.8 bits (120), Expect = 2e-06 Identities = 26/47 (55%), Positives = 33/47 (70%) Frame = +1 Query: 46 MDGIVYNDRKMKHFLMILIHLLEILKKGWLNLKIHSLNE*TIELDSV 186 MDG+ YND +MK I I+ L ILK GWLNLKI SLN+ I+L ++ Sbjct: 1 MDGVAYNDGQMKDSPKIFIYPLPILKIGWLNLKIPSLNKEPIQLHAL 47