BLASTX nr result
ID: Magnolia22_contig00024761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00024761 (1205 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO99518.1 hypothetical protein CCACVL1_03761 [Corchorus capsula... 68 2e-11 OMP12261.1 ORF45 protein [Corchorus olitorius] 65 3e-10 OMP08513.1 ORF45 protein [Corchorus olitorius] 62 3e-09 NP_054986.1 ORF45 protein (plastid) [Spinacia oleracea] CAB88782... 59 4e-08 AAA84691.1 unknown (chloroplast) [Nicotiana tabacum] 54 3e-06 ABN08797.1 hypothetical protein MtrDRAFT_AC160516g49v2 [Medicago... 53 5e-06 OMP07415.1 hypothetical protein CCACVL1_01308 [Corchorus capsula... 53 5e-06 >OMO99518.1 hypothetical protein CCACVL1_03761 [Corchorus capsularis] OMP12483.1 ORF45 protein [Corchorus olitorius] OMP13163.1 ORF45 protein [Corchorus olitorius] OMP13398.1 ORF45 protein [Corchorus olitorius] OMP13977.1 ORF45 protein [Corchorus olitorius] OMP14055.1 ORF45 protein [Corchorus olitorius] Length = 38 Score = 68.2 bits (165), Expect = 2e-11 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 208 MGYYYFDQAAMVKSVDTLLLGSSARASRFESEWRH 104 MGYY F QAAMVKSVDTLLLGSSARASRFESEWRH Sbjct: 1 MGYYDFKQAAMVKSVDTLLLGSSARASRFESEWRH 35 >OMP12261.1 ORF45 protein [Corchorus olitorius] Length = 38 Score = 65.1 bits (157), Expect = 3e-10 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -2 Query: 208 MGYYYFDQAAMVKSVDTLLLGSSARASRFESEWRH 104 MGYY F QAAMVKSV TLLLGSSARASRFESEWRH Sbjct: 1 MGYYDFKQAAMVKSVATLLLGSSARASRFESEWRH 35 >OMP08513.1 ORF45 protein [Corchorus olitorius] Length = 38 Score = 62.0 bits (149), Expect = 3e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 208 MGYYYFDQAAMVKSVDTLLLGSSARASRFESEWRH 104 MGYY F QAAMVK V+TLLLG++ARASRFESEWRH Sbjct: 1 MGYYDFKQAAMVKPVNTLLLGNNARASRFESEWRH 35 >NP_054986.1 ORF45 protein (plastid) [Spinacia oleracea] CAB88782.1 ORF45 protein (chloroplast) [Spinacia oleracea] Length = 45 Score = 59.3 bits (142), Expect = 4e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -2 Query: 208 MGYYYFDQAAMVKSVDTLLLGSSARASRFESEWRH 104 MGYY F +AAMVK VDTLLLGSSARASRFESE RH Sbjct: 1 MGYYDFKEAAMVKLVDTLLLGSSARASRFESESRH 35 >AAA84691.1 unknown (chloroplast) [Nicotiana tabacum] Length = 35 Score = 53.5 bits (127), Expect = 3e-06 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -2 Query: 187 QAAMVKSVDTLLLGSSARASRFESEWRH 104 QAAMVK VDTLLLGSSA ASRFESEWRH Sbjct: 5 QAAMVKLVDTLLLGSSANASRFESEWRH 32 >ABN08797.1 hypothetical protein MtrDRAFT_AC160516g49v2 [Medicago truncatula] Length = 40 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 105 CRHSDSNRDALALLPKSSVSTDFTMAA*SK 194 CR+SDSNRDALALLPKSSVST+FT+AA SK Sbjct: 10 CRYSDSNRDALALLPKSSVSTNFTIAAYSK 39 >OMP07415.1 hypothetical protein CCACVL1_01308 [Corchorus capsularis] Length = 28 Score = 52.8 bits (125), Expect = 5e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 178 MVKSVDTLLLGSSARASRFESEWRH 104 MVKSVDTLLLGSSARASRFESEWRH Sbjct: 1 MVKSVDTLLLGSSARASRFESEWRH 25