BLASTX nr result
ID: Magnolia22_contig00024743
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00024743 (503 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009216767.1 hypothetical protein GGTG_00752 [Gaeumannomyces t... 53 3e-06 KXT00868.1 hypothetical protein AC578_955 [Mycosphaerella eumusae] 53 4e-06 XP_002483750.1 hypothetical protein TSTA_015980 [Talaromyces sti... 51 6e-06 >XP_009216767.1 hypothetical protein GGTG_00752 [Gaeumannomyces tritici R3-111a-1] EJT80758.1 hypothetical protein GGTG_00752 [Gaeumannomyces tritici R3-111a-1] Length = 79 Score = 52.8 bits (125), Expect = 3e-06 Identities = 21/38 (55%), Positives = 24/38 (63%) Frame = -3 Query: 240 RAANRAQPWRAHWPPKKASTGGAPYGFKKGEKIVIYGN 127 R RAQPW HWPP + + YGFKKGE + IYGN Sbjct: 42 REDGRAQPWLQHWPPSRGTAVSTAYGFKKGETVHIYGN 79 >KXT00868.1 hypothetical protein AC578_955 [Mycosphaerella eumusae] Length = 103 Score = 52.8 bits (125), Expect = 4e-06 Identities = 22/36 (61%), Positives = 27/36 (75%) Frame = -3 Query: 234 ANRAQPWRAHWPPKKASTGGAPYGFKKGEKIVIYGN 127 A +AQPW++HWPPK T APYGFKKG+ I+ GN Sbjct: 69 APKAQPWKSHWPPKSIDT-SAPYGFKKGDTIINSGN 103 >XP_002483750.1 hypothetical protein TSTA_015980 [Talaromyces stipitatus ATCC 10500] XP_002483751.1 hypothetical protein TSTA_015980 [Talaromyces stipitatus ATCC 10500] EED16516.1 hypothetical protein TSTA_015980 [Talaromyces stipitatus ATCC 10500] EED16517.1 hypothetical protein TSTA_015980 [Talaromyces stipitatus ATCC 10500] Length = 56 Score = 51.2 bits (121), Expect = 6e-06 Identities = 20/40 (50%), Positives = 24/40 (60%) Frame = -3 Query: 246 TDRAANRAQPWRAHWPPKKASTGGAPYGFKKGEKIVIYGN 127 T R+QPW+ HWPP+K YGF KGE + IYGN Sbjct: 17 TSTKEKRSQPWKTHWPPQKNIPDQKAYGFAKGETVAIYGN 56