BLASTX nr result
ID: Magnolia22_contig00024565
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00024565 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018004021.1 putative thiosulfate sulfurtransferase, mitochond... 61 7e-09 XP_013271157.1 hypothetical protein Z518_07574 [Rhinocladiella m... 53 8e-06 >XP_018004021.1 putative thiosulfate sulfurtransferase, mitochondrial [Phialophora attae] KPI44058.1 putative thiosulfate sulfurtransferase, mitochondrial [Phialophora attae] Length = 219 Score = 61.2 bits (147), Expect = 7e-09 Identities = 34/67 (50%), Positives = 43/67 (64%), Gaps = 7/67 (10%) Frame = -2 Query: 182 NNLTRQFSTCLRFWKEADPPS-------PSGIAPPKSYSYHEIVDLTTSPSPNQILIDVR 24 N + R +ST KEA PPS P+ + PP Y+Y EI L++SP P++ILIDVR Sbjct: 66 NIIGRDYSTSPISRKEAPPPSSSQPPPQPTELKPPTLYTYPEIASLSSSPDPSRILIDVR 125 Query: 23 EPSELLA 3 EPSELLA Sbjct: 126 EPSELLA 132 >XP_013271157.1 hypothetical protein Z518_07574 [Rhinocladiella mackenziei CBS 650.93] KIX04021.1 hypothetical protein Z518_07574 [Rhinocladiella mackenziei CBS 650.93] Length = 206 Score = 52.8 bits (125), Expect = 8e-06 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = -2 Query: 170 RQFSTCLRFWKEADPPSPSGIAPPKSYSYHEIVDLTTSPSPNQILIDVREPSEL 9 R F+T L K+ D S + PP Y++ EI L +PSPN+ILIDVREPSEL Sbjct: 64 RHFTTTLAARKD-DSSSSTSTTPPTIYTFSEIQSLADTPSPNRILIDVREPSEL 116