BLASTX nr result
ID: Magnolia22_contig00023475
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00023475 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013320822.1 hypothetical protein PV05_00470 [Exophiala xenobi... 114 2e-27 XP_016225147.1 hypothetical protein PV10_04778 [Exophiala mesoph... 108 2e-25 XP_016259468.1 hypothetical protein PV06_09042 [Exophiala oligos... 107 1e-24 XP_016254638.1 hypothetical protein PV07_01200 [Cladophialophora... 105 3e-24 OCT44408.1 translation initiation factor 4B [Cladophialophora ca... 104 7e-24 KIW63671.1 hypothetical protein PV04_08656 [Capronia semi-immers... 102 7e-23 KIV87638.1 hypothetical protein PV11_03170 [Exophiala sideris] 102 7e-23 XP_013275542.1 hypothetical protein Z518_03062 [Rhinocladiella m... 100 2e-22 KKY26993.1 putative translation initiation factor 4b [Phaeomonie... 97 5e-21 XP_007728028.1 hypothetical protein A1O1_08981 [Capronia coronat... 94 5e-20 XP_016259469.1 hypothetical protein, variant [Exophiala oligospe... 93 9e-20 OAL40496.1 hypothetical protein AYO20_00232 [Fonsecaea nubica] 93 1e-19 OAG43189.1 hypothetical protein AYO21_02475 [Fonsecaea monophora] 93 1e-19 XP_007801307.1 hypothetical protein EPUS_08608 [Endocarpon pusil... 92 2e-19 XP_009153551.1 translation initiation factor eIF-4B [Exophiala d... 92 3e-19 XP_018698317.1 hypothetical protein AYL99_00922 [Fonsecaea erect... 91 4e-19 KIN04982.1 hypothetical protein OIDMADRAFT_177323 [Oidiodendron ... 91 4e-19 GAD97760.1 predicted protein, partial [Byssochlamys spectabilis ... 89 1e-18 XP_007751311.1 hypothetical protein A1O5_12552 [Cladophialophora... 90 1e-18 XP_012743327.1 hypothetical protein GMDG_04900 [Pseudogymnoascus... 90 2e-18 >XP_013320822.1 hypothetical protein PV05_00470 [Exophiala xenobiotica] KIW60238.1 hypothetical protein PV05_00470 [Exophiala xenobiotica] Length = 560 Score = 114 bits (286), Expect = 2e-27 Identities = 58/85 (68%), Positives = 65/85 (76%) Frame = +1 Query: 103 MGPKKNQKMSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGAS 282 MGPKKNQKMSLGTFLQD++YGSWADEMEDMPLPA+DS+ SY A RR +G T MGG Sbjct: 1 MGPKKNQKMSLGTFLQDENYGSWADEMEDMPLPASDSRPSY--ATERRTFGSTTGMGGGF 58 Query: 283 FGGRDLSQYSQREQLPLPDKPPYTA 357 RD + REQLPLP +PPYTA Sbjct: 59 SERRD--TFPSREQLPLPTEPPYTA 81 >XP_016225147.1 hypothetical protein PV10_04778 [Exophiala mesophila] KIV93573.1 hypothetical protein PV10_04778 [Exophiala mesophila] Length = 535 Score = 108 bits (271), Expect = 2e-25 Identities = 56/85 (65%), Positives = 66/85 (77%) Frame = +1 Query: 103 MGPKKNQKMSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGAS 282 MGPKKNQKMSLGTFLQD++YGSWADEMEDMPLP++DS+ +YGS RR +G ++ GA Sbjct: 1 MGPKKNQKMSLGTFLQDENYGSWADEMEDMPLPSSDSRPTYGS--ERRTFGPSS--SGAG 56 Query: 283 FGGRDLSQYSQREQLPLPDKPPYTA 357 F R Y REQLPLP +PPYTA Sbjct: 57 FSDR-RDGYPPREQLPLPTQPPYTA 80 >XP_016259468.1 hypothetical protein PV06_09042 [Exophiala oligosperma] KIW39252.1 hypothetical protein PV06_09042 [Exophiala oligosperma] Length = 537 Score = 107 bits (266), Expect = 1e-24 Identities = 55/85 (64%), Positives = 63/85 (74%) Frame = +1 Query: 103 MGPKKNQKMSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGAS 282 M PKKNQKMSLGTFLQD+++GSWADEMEDMPLPA+DS+ SY S RR Y +GG Sbjct: 1 MPPKKNQKMSLGTFLQDENFGSWADEMEDMPLPASDSRPSYAS--ERRTYSTAPSLGGGF 58 Query: 283 FGGRDLSQYSQREQLPLPDKPPYTA 357 RD Y+ REQLPLP +PPYTA Sbjct: 59 SERRD--TYATREQLPLPTQPPYTA 81 >XP_016254638.1 hypothetical protein PV07_01200 [Cladophialophora immunda] KIW34422.1 hypothetical protein PV07_01200 [Cladophialophora immunda] Length = 551 Score = 105 bits (263), Expect = 3e-24 Identities = 54/85 (63%), Positives = 62/85 (72%) Frame = +1 Query: 103 MGPKKNQKMSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGAS 282 M PKKNQKMSLGTFLQD++YGSWADEMEDMPLP +D++ SYGS RR + T MG Sbjct: 1 MAPKKNQKMSLGTFLQDENYGSWADEMEDMPLPTSDTRPSYGS--ERRAFSTTTGMGNGY 58 Query: 283 FGGRDLSQYSQREQLPLPDKPPYTA 357 RD Y REQLPLP +PP+TA Sbjct: 59 PDRRD--TYPAREQLPLPTQPPFTA 81 >OCT44408.1 translation initiation factor 4B [Cladophialophora carrionii] Length = 547 Score = 104 bits (260), Expect = 7e-24 Identities = 55/86 (63%), Positives = 62/86 (72%), Gaps = 1/86 (1%) Frame = +1 Query: 103 MGPKKNQKMSLGTFLQDDSYGSWADEMEDMPLP-ATDSQKSYGSAPPRRDYGGNTDMGGA 279 M PKKNQKMSLGTFLQD++YGSWADEMEDMPLP A+D++ SYGS RR + T MG Sbjct: 1 MPPKKNQKMSLGTFLQDENYGSWADEMEDMPLPTASDTRPSYGS--DRRAFSTATGMGNG 58 Query: 280 SFGGRDLSQYSQREQLPLPDKPPYTA 357 YS REQLPLP +PPYTA Sbjct: 59 YQSVERRDTYSMREQLPLPTQPPYTA 84 >KIW63671.1 hypothetical protein PV04_08656 [Capronia semi-immersa] KIW63672.1 hypothetical protein, variant [Capronia semi-immersa] Length = 546 Score = 102 bits (253), Expect = 7e-23 Identities = 57/87 (65%), Positives = 65/87 (74%), Gaps = 2/87 (2%) Frame = +1 Query: 103 MGPKKNQKMSLGTFLQDDSYGSWADEMEDMPLP-ATDSQKSYGSAPPRRDYGGNTDMG-G 276 M PKKNQKMSLGTFLQD++YGSWADEMEDMPLP A+DS+ SYGS RR + + MG G Sbjct: 1 MPPKKNQKMSLGTFLQDENYGSWADEMEDMPLPSASDSRPSYGS--DRRAFSTASGMGNG 58 Query: 277 ASFGGRDLSQYSQREQLPLPDKPPYTA 357 RD+ Y REQLPLP +PPYTA Sbjct: 59 YQSERRDM--YPSREQLPLPTQPPYTA 83 >KIV87638.1 hypothetical protein PV11_03170 [Exophiala sideris] Length = 549 Score = 102 bits (253), Expect = 7e-23 Identities = 57/87 (65%), Positives = 66/87 (75%), Gaps = 2/87 (2%) Frame = +1 Query: 103 MGPKKN-QKMSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMG-G 276 MGPKKN QKMSLGTFLQD++YGSWADEMEDMPLP++D + SYGS+ RR + NT MG G Sbjct: 1 MGPKKNTQKMSLGTFLQDENYGSWADEMEDMPLPSSD-RPSYGSS-ERRTFSTNTGMGMG 58 Query: 277 ASFGGRDLSQYSQREQLPLPDKPPYTA 357 F R Y REQLPLP +PP+TA Sbjct: 59 NGFADR-RDGYPSREQLPLPTEPPFTA 84 >XP_013275542.1 hypothetical protein Z518_03062 [Rhinocladiella mackenziei CBS 650.93] KIX08406.1 hypothetical protein Z518_03062 [Rhinocladiella mackenziei CBS 650.93] Length = 554 Score = 100 bits (249), Expect = 2e-22 Identities = 51/83 (61%), Positives = 61/83 (73%) Frame = +1 Query: 109 PKKNQKMSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGASFG 288 PKKNQKMSLGTFLQD++YGSWADEMEDMPLP +D++ SYG+ RR + T MG Sbjct: 19 PKKNQKMSLGTFLQDENYGSWADEMEDMPLPPSDNRPSYGT--DRRAFSSATGMGNGLPE 76 Query: 289 GRDLSQYSQREQLPLPDKPPYTA 357 RD + REQLPLP +PP+TA Sbjct: 77 RRD--TFPAREQLPLPTQPPFTA 97 >KKY26993.1 putative translation initiation factor 4b [Phaeomoniella chlamydospora] Length = 549 Score = 96.7 bits (239), Expect = 5e-21 Identities = 52/87 (59%), Positives = 61/87 (70%), Gaps = 2/87 (2%) Frame = +1 Query: 103 MGPK-KNQKMSLGTFLQDDSYGSWADEMEDMPLP-ATDSQKSYGSAPPRRDYGGNTDMGG 276 M PK K +KMSLG FL D++YGSWADEMEDMPLP ATD+ ++ RR + MGG Sbjct: 1 MAPKAKKEKMSLGAFLSDENYGSWADEMEDMPLPSATDNSRTSYGGGERRAFSSAGGMGG 60 Query: 277 ASFGGRDLSQYSQREQLPLPDKPPYTA 357 ASF D QYS REQLPLP +PP+TA Sbjct: 61 ASF---DRPQYSVREQLPLPTEPPFTA 84 >XP_007728028.1 hypothetical protein A1O1_08981 [Capronia coronata CBS 617.96] EXJ78580.1 hypothetical protein A1O1_08981 [Capronia coronata CBS 617.96] Length = 533 Score = 94.0 bits (232), Expect = 5e-20 Identities = 45/77 (58%), Positives = 56/77 (72%) Frame = +1 Query: 127 MSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGASFGGRDLSQ 306 MSLGTFLQD+++GSWADEMEDMPLP++DS+ SYG R +G ++ MG RD Sbjct: 1 MSLGTFLQDENFGSWADEMEDMPLPSSDSRPSYGGGSGPRTFGPSSGMGNGYSDRRD--T 58 Query: 307 YSQREQLPLPDKPPYTA 357 Y REQLPLP +PP+TA Sbjct: 59 YQTREQLPLPTQPPFTA 75 >XP_016259469.1 hypothetical protein, variant [Exophiala oligosperma] KIW39253.1 hypothetical protein, variant [Exophiala oligosperma] Length = 529 Score = 93.2 bits (230), Expect = 9e-20 Identities = 48/77 (62%), Positives = 56/77 (72%) Frame = +1 Query: 127 MSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGASFGGRDLSQ 306 MSLGTFLQD+++GSWADEMEDMPLPA+DS+ SY S RR Y +GG RD Sbjct: 1 MSLGTFLQDENFGSWADEMEDMPLPASDSRPSYAS--ERRTYSTAPSLGGGFSERRD--T 56 Query: 307 YSQREQLPLPDKPPYTA 357 Y+ REQLPLP +PPYTA Sbjct: 57 YATREQLPLPTQPPYTA 73 >OAL40496.1 hypothetical protein AYO20_00232 [Fonsecaea nubica] Length = 544 Score = 92.8 bits (229), Expect = 1e-19 Identities = 48/77 (62%), Positives = 55/77 (71%) Frame = +1 Query: 127 MSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGASFGGRDLSQ 306 MSLGTFLQD++YGSWADEMEDMPLP +D++ SYGS RR + T MG RD Sbjct: 1 MSLGTFLQDENYGSWADEMEDMPLPTSDTRPSYGS--ERRAFSTTTGMGNGYPDRRD--T 56 Query: 307 YSQREQLPLPDKPPYTA 357 Y REQLPLP +PPYTA Sbjct: 57 YPAREQLPLPTQPPYTA 73 >OAG43189.1 hypothetical protein AYO21_02475 [Fonsecaea monophora] Length = 544 Score = 92.8 bits (229), Expect = 1e-19 Identities = 48/77 (62%), Positives = 55/77 (71%) Frame = +1 Query: 127 MSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGASFGGRDLSQ 306 MSLGTFLQD++YGSWADEMEDMPLP +D++ SYGS RR + T MG RD Sbjct: 1 MSLGTFLQDENYGSWADEMEDMPLPTSDTRPSYGS--ERRAFSTTTGMGNGYPDRRD--T 56 Query: 307 YSQREQLPLPDKPPYTA 357 Y REQLPLP +PPYTA Sbjct: 57 YPAREQLPLPTQPPYTA 73 >XP_007801307.1 hypothetical protein EPUS_08608 [Endocarpon pusillum Z07020] ERF73044.1 hypothetical protein EPUS_08608 [Endocarpon pusillum Z07020] Length = 533 Score = 92.4 bits (228), Expect = 2e-19 Identities = 47/77 (61%), Positives = 54/77 (70%) Frame = +1 Query: 127 MSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGASFGGRDLSQ 306 MSLGTFLQD++YGSWADEMEDMPLP+T+S+ YG RR + T MG RD Sbjct: 1 MSLGTFLQDENYGSWADEMEDMPLPSTESRSGYGG--ERRAFSSTTGMGNGYNDRRD--G 56 Query: 307 YSQREQLPLPDKPPYTA 357 Y REQLPLP +PPYTA Sbjct: 57 YPPREQLPLPTEPPYTA 73 >XP_009153551.1 translation initiation factor eIF-4B [Exophiala dermatitidis NIH/UT8656] EHY53090.1 translation initiation factor eIF-4B [Exophiala dermatitidis NIH/UT8656] Length = 540 Score = 91.7 bits (226), Expect = 3e-19 Identities = 45/77 (58%), Positives = 58/77 (75%) Frame = +1 Query: 127 MSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGASFGGRDLSQ 306 MSLGTFLQD+++GSWADEMEDMPLP++DS+ +YGS RR +G ++ MG F R Sbjct: 1 MSLGTFLQDENFGSWADEMEDMPLPSSDSRPTYGS--ERRTFGASSGMGN-GFPERRADG 57 Query: 307 YSQREQLPLPDKPPYTA 357 Y RE+LPLP +PP+TA Sbjct: 58 YHVREELPLPKEPPFTA 74 >XP_018698317.1 hypothetical protein AYL99_00922 [Fonsecaea erecta] OAP64950.1 hypothetical protein AYL99_00922 [Fonsecaea erecta] Length = 547 Score = 91.3 bits (225), Expect = 4e-19 Identities = 47/77 (61%), Positives = 55/77 (71%) Frame = +1 Query: 127 MSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGASFGGRDLSQ 306 MSLGTFLQD++YGSWADEMEDMPLP +D++ SYGS RR + T MG RD Sbjct: 1 MSLGTFLQDENYGSWADEMEDMPLPTSDTRPSYGS--ERRAFSTTTGMGNGYQERRD--T 56 Query: 307 YSQREQLPLPDKPPYTA 357 Y REQLPLP +PP+TA Sbjct: 57 YPAREQLPLPTQPPFTA 73 >KIN04982.1 hypothetical protein OIDMADRAFT_177323 [Oidiodendron maius Zn] Length = 567 Score = 91.3 bits (225), Expect = 4e-19 Identities = 51/86 (59%), Positives = 57/86 (66%), Gaps = 2/86 (2%) Frame = +1 Query: 103 MGPKKN--QKMSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGG 276 M PKK QKMSLG FL D+ GSWADEMEDMP+ S+ SYG AP RR Y T Sbjct: 1 MAPKKKEQQKMSLGAFLTDEKMGSWADEMEDMPV---YSRTSYG-APERRTYNSTT---- 52 Query: 277 ASFGGRDLSQYSQREQLPLPDKPPYT 354 +FGG + YS RE+LPLPDKPPYT Sbjct: 53 GTFGGSSMGGYSVREELPLPDKPPYT 78 >GAD97760.1 predicted protein, partial [Byssochlamys spectabilis No. 5] Length = 306 Score = 88.6 bits (218), Expect = 1e-18 Identities = 47/81 (58%), Positives = 54/81 (66%) Frame = +1 Query: 115 KNQKMSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGASFGGR 294 K QKMS+GTFL D+S GSWADEMEDMPLPA SQ SYG RR G T G R Sbjct: 20 KAQKMSIGTFLADESLGSWADEMEDMPLPAPSSQTSYGG--ERRTMGNATGFMGYD---R 74 Query: 295 DLSQYSQREQLPLPDKPPYTA 357 D + ++ R +LPLP +PPYTA Sbjct: 75 DRTSFAPRAELPLPTQPPYTA 95 >XP_007751311.1 hypothetical protein A1O5_12552 [Cladophialophora psammophila CBS 110553] EXJ56285.1 hypothetical protein A1O5_12552 [Cladophialophora psammophila CBS 110553] Length = 541 Score = 90.1 bits (222), Expect = 1e-18 Identities = 46/77 (59%), Positives = 55/77 (71%) Frame = +1 Query: 127 MSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGGASFGGRDLSQ 306 MSLGTFLQD++YGSWADEMEDMPLP +D++ SYGS RR + T MG RD Sbjct: 1 MSLGTFLQDENYGSWADEMEDMPLPTSDARPSYGS--ERRAFSTTTGMGNGYAERRD--T 56 Query: 307 YSQREQLPLPDKPPYTA 357 + REQLPLP +PP+TA Sbjct: 57 FPAREQLPLPTQPPFTA 73 >XP_012743327.1 hypothetical protein GMDG_04900 [Pseudogymnoascus destructans 20631-21] ELR10631.1 hypothetical protein GMDG_04900 [Pseudogymnoascus destructans 20631-21] Length = 561 Score = 89.7 bits (221), Expect = 2e-18 Identities = 48/86 (55%), Positives = 59/86 (68%), Gaps = 2/86 (2%) Frame = +1 Query: 103 MGPKKN--QKMSLGTFLQDDSYGSWADEMEDMPLPATDSQKSYGSAPPRRDYGGNTDMGG 276 MGPKK QKMSLG F+ D+ GSWADEMEDMP+ +DS+ YG+ +R YG Sbjct: 1 MGPKKKEQQKMSLGAFMTDEKLGSWADEMEDMPV--SDSRSGYGA--EKRTYGST----N 52 Query: 277 ASFGGRDLSQYSQREQLPLPDKPPYT 354 +FG +L+ YS RE+LPLPDKPPYT Sbjct: 53 TTFGSGNLAGYSVREELPLPDKPPYT 78