BLASTX nr result
ID: Magnolia22_contig00023444
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00023444 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KKY21126.1 putative transcription factor [Phaeomoniella chlamydo... 94 3e-20 KMQ45184.1 von Willebrand factor, type A [Trichophyton rubrum] 90 5e-19 XP_003233390.1 transcription factor RfeF [Trichophyton rubrum CB... 90 5e-19 EZF24993.1 hypothetical protein H100_02629 [Trichophyton rubrum ... 90 5e-19 XP_003017452.1 hypothetical protein ARB_04333 [Trichophyton benh... 90 6e-19 EZF24992.1 hypothetical protein H100_02629 [Trichophyton rubrum ... 90 6e-19 DAA79571.1 TPA_exp: Uncharacterized protein A8136_0344 [Trichoph... 90 6e-19 OAL71209.1 hypothetical protein A7D00_4873 [Trichophyton violaceum] 90 6e-19 EZF24991.1 hypothetical protein H100_02629 [Trichophyton rubrum ... 90 6e-19 XP_003022690.1 hypothetical protein TRV_03211 [Trichophyton verr... 90 6e-19 OAL67891.1 hypothetical protein A7C99_1023 [Trichophyton rubrum] 90 7e-19 XP_016241776.1 hypothetical protein PV08_02140 [Exophiala spinif... 90 9e-19 XP_002845335.1 RfeF [Arthroderma otae CBS 113480] EEQ32385.1 Rfe... 89 1e-18 XP_016259057.1 hypothetical protein, variant [Exophiala oligospe... 89 1e-18 EGE05665.1 hypothetical protein TEQG_08702 [Trichophyton equinum... 89 1e-18 XP_003171698.1 hypothetical protein MGYG_06246 [Nannizzia gypsea... 89 1e-18 XP_016259056.1 hypothetical protein PV06_08674 [Exophiala oligos... 89 1e-18 EGD96440.1 transcription factor RfeF [Trichophyton tonsurans CBS... 89 1e-18 KDB26330.1 hypothetical protein H109_01904 [Trichophyton interdi... 89 1e-18 XP_013320471.1 hypothetical protein, variant 2 [Exophiala xenobi... 88 2e-18 >KKY21126.1 putative transcription factor [Phaeomoniella chlamydospora] Length = 584 Score = 94.0 bits (232), Expect = 3e-20 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQS 167 DCTSNFEVEQDEMSRANPPV+LTPELWLIKLLLGSID SYD KDE++QS Sbjct: 456 DCTSNFEVEQDEMSRANPPVDLTPELWLIKLLLGSIDSSYDTKDEKSQS 504 >KMQ45184.1 von Willebrand factor, type A [Trichophyton rubrum] Length = 439 Score = 90.1 bits (222), Expect = 5e-19 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K+LLG+ID SYD KDE+TQ Sbjct: 327 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMLLGAIDSSYDTKDEKTQ 374 >XP_003233390.1 transcription factor RfeF [Trichophyton rubrum CBS 118892] Length = 460 Score = 90.1 bits (222), Expect = 5e-19 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K+LLG+ID SYD KDE+TQ Sbjct: 327 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMLLGAIDSSYDTKDEKTQ 374 >EZF24993.1 hypothetical protein H100_02629 [Trichophyton rubrum MR850] EZF43992.1 hypothetical protein H102_02620 [Trichophyton rubrum CBS 100081] EZF54654.1 hypothetical protein H103_02633 [Trichophyton rubrum CBS 288.86] EZF65231.1 hypothetical protein H104_02611 [Trichophyton rubrum CBS 289.86] EZF75931.1 hypothetical protein H105_02638 [Trichophyton soudanense CBS 452.61] EZF86552.1 hypothetical protein H110_02628 [Trichophyton rubrum MR1448] EZF97318.1 hypothetical protein H113_02638 [Trichophyton rubrum MR1459] EZG08310.1 hypothetical protein H106_02490 [Trichophyton rubrum CBS 735.88] EZG18860.1 hypothetical protein H107_02707 [Trichophyton rubrum CBS 202.88] KDB35766.1 hypothetical protein H112_02622 [Trichophyton rubrum D6] KFL62303.1 hypothetical protein TERG_06379 [Trichophyton rubrum CBS 118892] Length = 467 Score = 90.1 bits (222), Expect = 5e-19 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K+LLG+ID SYD KDE+TQ Sbjct: 334 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMLLGAIDSSYDTKDEKTQ 381 >XP_003017452.1 hypothetical protein ARB_04333 [Trichophyton benhamiae CBS 112371] EFE36807.1 hypothetical protein ARB_04333 [Trichophyton benhamiae CBS 112371] Length = 471 Score = 90.1 bits (222), Expect = 6e-19 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K+LLG+ID SYD KDE+TQ Sbjct: 339 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMLLGAIDSSYDTKDEKTQ 386 >EZF24992.1 hypothetical protein H100_02629 [Trichophyton rubrum MR850] EZF43991.1 hypothetical protein H102_02620 [Trichophyton rubrum CBS 100081] EZF54653.1 hypothetical protein H103_02633 [Trichophyton rubrum CBS 288.86] EZF65230.1 hypothetical protein H104_02611 [Trichophyton rubrum CBS 289.86] EZF75930.1 hypothetical protein H105_02638 [Trichophyton soudanense CBS 452.61] EZF86551.1 hypothetical protein H110_02628 [Trichophyton rubrum MR1448] EZF97317.1 hypothetical protein H113_02638 [Trichophyton rubrum MR1459] EZG08309.1 hypothetical protein H106_02490 [Trichophyton rubrum CBS 735.88] EZG18859.1 hypothetical protein H107_02707 [Trichophyton rubrum CBS 202.88] KDB35765.1 hypothetical protein H112_02622 [Trichophyton rubrum D6] KFL62302.1 hypothetical protein TERG_06379 [Trichophyton rubrum CBS 118892] Length = 473 Score = 90.1 bits (222), Expect = 6e-19 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K+LLG+ID SYD KDE+TQ Sbjct: 340 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMLLGAIDSSYDTKDEKTQ 387 >DAA79571.1 TPA_exp: Uncharacterized protein A8136_0344 [Trichophyton benhamiae CBS 112371] Length = 569 Score = 90.1 bits (222), Expect = 6e-19 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K+LLG+ID SYD KDE+TQ Sbjct: 437 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMLLGAIDSSYDTKDEKTQ 484 >OAL71209.1 hypothetical protein A7D00_4873 [Trichophyton violaceum] Length = 571 Score = 90.1 bits (222), Expect = 6e-19 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K+LLG+ID SYD KDE+TQ Sbjct: 438 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMLLGAIDSSYDTKDEKTQ 485 >EZF24991.1 hypothetical protein H100_02629 [Trichophyton rubrum MR850] EZF43990.1 hypothetical protein H102_02620 [Trichophyton rubrum CBS 100081] EZF54652.1 hypothetical protein H103_02633 [Trichophyton rubrum CBS 288.86] EZF65229.1 hypothetical protein H104_02611 [Trichophyton rubrum CBS 289.86] EZF75929.1 hypothetical protein H105_02638 [Trichophyton soudanense CBS 452.61] EZF86550.1 hypothetical protein H110_02628 [Trichophyton rubrum MR1448] EZF97316.1 hypothetical protein H113_02638 [Trichophyton rubrum MR1459] EZG08308.1 hypothetical protein H106_02490 [Trichophyton rubrum CBS 735.88] EZG18858.1 hypothetical protein H107_02707 [Trichophyton rubrum CBS 202.88] KDB35764.1 hypothetical protein H112_02622 [Trichophyton rubrum D6] EGD90149.2 hypothetical protein TERG_06379 [Trichophyton rubrum CBS 118892] Length = 577 Score = 90.1 bits (222), Expect = 6e-19 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K+LLG+ID SYD KDE+TQ Sbjct: 444 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMLLGAIDSSYDTKDEKTQ 491 >XP_003022690.1 hypothetical protein TRV_03211 [Trichophyton verrucosum HKI 0517] EFE42072.1 hypothetical protein TRV_03211 [Trichophyton verrucosum HKI 0517] Length = 578 Score = 90.1 bits (222), Expect = 6e-19 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K+LLG+ID SYD KDE+TQ Sbjct: 446 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMLLGAIDSSYDTKDEKTQ 493 >OAL67891.1 hypothetical protein A7C99_1023 [Trichophyton rubrum] Length = 915 Score = 90.1 bits (222), Expect = 7e-19 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K+LLG+ID SYD KDE+TQ Sbjct: 782 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMLLGAIDSSYDTKDEKTQ 829 >XP_016241776.1 hypothetical protein PV08_02140 [Exophiala spinifera] KIW21560.1 hypothetical protein PV08_02140 [Exophiala spinifera] Length = 544 Score = 89.7 bits (221), Expect = 9e-19 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQS 167 DCTSN+EVE DEMSRANPPVNLTPELWLIKLLLGSID SYD KDE++ + Sbjct: 412 DCTSNYEVEADEMSRANPPVNLTPELWLIKLLLGSIDSSYDSKDEKSNA 460 >XP_002845335.1 RfeF [Arthroderma otae CBS 113480] EEQ32385.1 RfeF [Arthroderma otae CBS 113480] Length = 476 Score = 89.4 bits (220), Expect = 1e-18 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K++LG+ID SYD KDE+TQ Sbjct: 344 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMMLGAIDSSYDTKDEKTQ 391 >XP_016259057.1 hypothetical protein, variant [Exophiala oligosperma] KIW38841.1 hypothetical protein, variant [Exophiala oligosperma] Length = 479 Score = 89.4 bits (220), Expect = 1e-18 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQS 167 DCTSN+EVE DEMSRANPPVNLTPELWLIKLLLGSID SYD KDE++ + Sbjct: 344 DCTSNYEVEADEMSRANPPVNLTPELWLIKLLLGSIDSSYDAKDEKSNA 392 >EGE05665.1 hypothetical protein TEQG_08702 [Trichophyton equinum CBS 127.97] Length = 510 Score = 89.4 bits (220), Expect = 1e-18 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K++LG+ID SYD KDE+TQ Sbjct: 378 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMMLGAIDSSYDTKDEKTQ 425 >XP_003171698.1 hypothetical protein MGYG_06246 [Nannizzia gypsea CBS 118893] EFR03244.1 hypothetical protein MGYG_06246 [Nannizzia gypsea CBS 118893] Length = 549 Score = 89.4 bits (220), Expect = 1e-18 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K++LG+ID SYD KDE+TQ Sbjct: 422 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMMLGAIDSSYDTKDEKTQ 469 >XP_016259056.1 hypothetical protein PV06_08674 [Exophiala oligosperma] KIW38840.1 hypothetical protein PV06_08674 [Exophiala oligosperma] Length = 554 Score = 89.4 bits (220), Expect = 1e-18 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQS 167 DCTSN+EVE DEMSRANPPVNLTPELWLIKLLLGSID SYD KDE++ + Sbjct: 419 DCTSNYEVEADEMSRANPPVNLTPELWLIKLLLGSIDSSYDAKDEKSNA 467 >EGD96440.1 transcription factor RfeF [Trichophyton tonsurans CBS 112818] Length = 569 Score = 89.4 bits (220), Expect = 1e-18 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K++LG+ID SYD KDE+TQ Sbjct: 437 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMMLGAIDSSYDTKDEKTQ 484 >KDB26330.1 hypothetical protein H109_01904 [Trichophyton interdigitale MR816] Length = 723 Score = 89.4 bits (220), Expect = 1e-18 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQ 170 DCTSNFEVEQDEMSRANPPV+LTPELWL K++LG+ID SYD KDE+TQ Sbjct: 591 DCTSNFEVEQDEMSRANPPVDLTPELWLAKMMLGAIDSSYDTKDEKTQ 638 >XP_013320471.1 hypothetical protein, variant 2 [Exophiala xenobiotica] KIW59888.1 hypothetical protein, variant 2 [Exophiala xenobiotica] Length = 339 Score = 87.8 bits (216), Expect = 2e-18 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -3 Query: 313 DCTSNFEVEQDEMSRANPPVNLTPELWLIKLLLGSIDHSYDKKDEQTQS 167 DCTSN+EVE DEMSRANPPVNL+PELWLIKLLLGSID SYD KDE++ + Sbjct: 211 DCTSNYEVEADEMSRANPPVNLSPELWLIKLLLGSIDSSYDTKDEKSSA 259