BLASTX nr result
ID: Magnolia22_contig00023426
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00023426 (324 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KGN43564.1 hypothetical protein Csa_7G045530 [Cucumis sativus] 69 2e-13 >KGN43564.1 hypothetical protein Csa_7G045530 [Cucumis sativus] Length = 80 Score = 69.3 bits (168), Expect = 2e-13 Identities = 37/54 (68%), Positives = 41/54 (75%) Frame = -1 Query: 270 FTLAAINISQSSRTSKWVWGNYDKVIVLCWLWGSKSSYIWRLCRILEGLSLDYG 109 FTLAA S+SSRT KWVW N VI L L S+SS+IWRLCR+LEGLSLDYG Sbjct: 29 FTLAAATSSKSSRTFKWVWDN--GVISLGVLRKSRSSHIWRLCRVLEGLSLDYG 80