BLASTX nr result
ID: Magnolia22_contig00023371
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00023371 (416 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002268639.1 PREDICTED: uncharacterized protein LOC100250100 i... 53 6e-06 >XP_002268639.1 PREDICTED: uncharacterized protein LOC100250100 isoform X2 [Vitis vinifera] CBI32089.3 unnamed protein product, partial [Vitis vinifera] Length = 175 Score = 53.1 bits (126), Expect = 6e-06 Identities = 33/70 (47%), Positives = 40/70 (57%), Gaps = 3/70 (4%) Frame = +1 Query: 4 ESDSEKQQQRIRRSLECLKEEGRRRSEWEKSIKDAKQERHQPKTAQCIMRS---KRQWRP 174 ES + Q R+S C EE RSE EKS + K ERH+P+TA + + WRP Sbjct: 108 ESAEKLQGMAERQSSSC--EEDGGRSEMEKSNQVVKHERHRPRTASTTSAAAARSKSWRP 165 Query: 175 SLQSISEVGS 204 SLQSISE GS Sbjct: 166 SLQSISEAGS 175