BLASTX nr result
ID: Magnolia22_contig00023152
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00023152 (401 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008720787.1 haloacid dehalogenase, type II [Cyphellophora eur... 64 1e-09 >XP_008720787.1 haloacid dehalogenase, type II [Cyphellophora europaea CBS 101466] ETN37255.1 haloacid dehalogenase, type II [Cyphellophora europaea CBS 101466] Length = 267 Score = 63.9 bits (154), Expect = 1e-09 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -2 Query: 400 EQWNEEQIEEAKQWVDMWVSISEPGFQEVAKRFGCSGNAA 281 E W E++++EAK WVDMWVS+ E GF+EVA+RFGCSG + Sbjct: 225 EGWKEDKVKEAKGWVDMWVSLGEGGFEEVARRFGCSGEGS 264