BLASTX nr result
ID: Magnolia22_contig00023084
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00023084 (348 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYC36881.1 hypothetical protein Y032_0847g2669 [Ancylostoma ceyl... 54 8e-07 >EYC36881.1 hypothetical protein Y032_0847g2669 [Ancylostoma ceylanicum] Length = 129 Score = 53.9 bits (128), Expect = 8e-07 Identities = 24/54 (44%), Positives = 37/54 (68%) Frame = -3 Query: 199 SRNQNECR*NKDIEMNE*QDGKDRIRSEDIQENLGVARIGEKIKESKLRWSGHV 38 SR +C ++D+ M+E DRIR+E I+E G+A I +K++E++LRW GHV Sbjct: 8 SRTPTKCDGDEDVTMDEGVTRADRIRNEKIRERFGIAPIADKLRETRLRWYGHV 61