BLASTX nr result
ID: Magnolia22_contig00021350
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00021350 (404 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010273730.1 PREDICTED: autophagy-related protein 11 [Nelumbo ... 58 3e-07 XP_010278198.1 PREDICTED: autophagy-related protein 11-like [Nel... 54 9e-06 >XP_010273730.1 PREDICTED: autophagy-related protein 11 [Nelumbo nucifera] Length = 1156 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 98 MSSIVTEDFVPGRKLVVHVAENGRTFELDCDE 3 MSS VTEDF GRKL+VH+AENG TFELDCDE Sbjct: 1 MSSSVTEDFASGRKLLVHIAENGHTFELDCDE 32 >XP_010278198.1 PREDICTED: autophagy-related protein 11-like [Nelumbo nucifera] Length = 1153 Score = 53.9 bits (128), Expect = 9e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 98 MSSIVTEDFVPGRKLVVHVAENGRTFELDCDE 3 MSS VTEDF P KL+VH+AENG +FELDCDE Sbjct: 1 MSSSVTEDFAPRGKLLVHIAENGHSFELDCDE 32