BLASTX nr result
ID: Magnolia22_contig00021326
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00021326 (717 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016260204.1 hypothetical protein, variant [Exophiala oligospe... 57 8e-06 >XP_016260204.1 hypothetical protein, variant [Exophiala oligosperma] XP_016260203.1 hypothetical protein PV06_08545 [Exophiala oligosperma] KIW39987.1 hypothetical protein PV06_08545 [Exophiala oligosperma] KIW39988.1 hypothetical protein, variant [Exophiala oligosperma] Length = 617 Score = 57.0 bits (136), Expect = 8e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 46 DPFSFLSGGMQGMNINDDGQGQRRNGGPQSAKSPA 150 DPFSFLS G+QG+++ D+ Q RRNGGPQ+AKSPA Sbjct: 583 DPFSFLSAGIQGLSVGDENQPPRRNGGPQTAKSPA 617