BLASTX nr result
ID: Magnolia22_contig00021164
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00021164 (559 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_020115148.1 lon protease homolog 2, peroxisomal-like [Ananas ... 85 2e-18 BAA77218.1 LON protease homologue, partial (mitochondrion) [Lith... 84 2e-16 XP_011032007.1 PREDICTED: lon protease homolog 2, peroxisomal-li... 87 2e-16 XP_002304362.2 Lon protease 1 family protein [Populus trichocarp... 87 2e-16 XP_011032006.1 PREDICTED: lon protease homolog 2, peroxisomal-li... 87 2e-16 XP_015869240.1 PREDICTED: lon protease homolog 2, peroxisomal-li... 86 3e-16 XP_015867936.1 PREDICTED: lon protease homolog 2, peroxisomal [Z... 86 4e-16 EPS62878.1 hypothetical protein M569_11910 [Genlisea aurea] 86 5e-16 XP_007156606.1 hypothetical protein PHAVU_002G002800g [Phaseolus... 78 6e-16 ONI06270.1 hypothetical protein PRUPE_5G050100 [Prunus persica] 85 6e-16 XP_016648968.1 PREDICTED: lon protease homolog 2, peroxisomal [P... 85 6e-16 XP_007210904.1 hypothetical protein PRUPE_ppa001173mg [Prunus pe... 85 6e-16 EYU17851.1 hypothetical protein MIMGU_mgv1a0010892mg, partial [E... 82 7e-16 KZN04759.1 hypothetical protein DCAR_005596 [Daucus carota subsp... 85 8e-16 XP_020115147.1 lon protease homolog 2, peroxisomal [Ananas comosus] 85 8e-16 XP_017235458.1 PREDICTED: lon protease homolog 2, peroxisomal-li... 85 8e-16 OAY77380.1 Lon protease, peroxisomal [Ananas comosus] 85 8e-16 XP_009341221.1 PREDICTED: lon protease homolog 2, peroxisomal-li... 85 8e-16 XP_008348469.1 PREDICTED: lon protease homolog 2, peroxisomal-li... 85 8e-16 XP_010941244.1 PREDICTED: lon protease homolog 2, peroxisomal-li... 85 8e-16 >XP_020115148.1 lon protease homolog 2, peroxisomal-like [Ananas comosus] Length = 81 Score = 84.7 bits (208), Expect = 2e-18 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDL EVP A+L+GME+L KRIEEVLE AFEGGCPWR+HA+L Sbjct: 34 LPERNLKDLTEVPSAILSGMEILLVKRIEEVLEHAFEGGCPWRKHAKL 81 >BAA77218.1 LON protease homologue, partial (mitochondrion) [Lithospermum erythrorhizon] Length = 222 Score = 83.6 bits (205), Expect = 2e-16 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDL EVP AVL+ +E++ AKR+E+VLEQAFEGGCPWRQH+RL Sbjct: 175 LPERNLKDLAEVPAAVLSSLEIILAKRMEDVLEQAFEGGCPWRQHSRL 222 >XP_011032007.1 PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 [Populus euphratica] Length = 842 Score = 86.7 bits (213), Expect = 2e-16 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDLVEVP AVL +E+LPAK++E+VLEQAFEGGCPWRQH++L Sbjct: 795 LPERNLKDLVEVPAAVLGSLEILPAKQMEDVLEQAFEGGCPWRQHSKL 842 >XP_002304362.2 Lon protease 1 family protein [Populus trichocarpa] EEE79341.2 Lon protease 1 family protein [Populus trichocarpa] Length = 893 Score = 86.7 bits (213), Expect = 2e-16 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDLVEVP AVL +E+LPAK++E+VLEQAFEGGCPWRQH++L Sbjct: 846 LPERNLKDLVEVPAAVLGSLEILPAKQMEDVLEQAFEGGCPWRQHSKL 893 >XP_011032006.1 PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 [Populus euphratica] Length = 895 Score = 86.7 bits (213), Expect = 2e-16 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDLVEVP AVL +E+LPAK++E+VLEQAFEGGCPWRQH++L Sbjct: 848 LPERNLKDLVEVPAAVLGSLEILPAKQMEDVLEQAFEGGCPWRQHSKL 895 >XP_015869240.1 PREDICTED: lon protease homolog 2, peroxisomal-like [Ziziphus jujuba] Length = 413 Score = 85.5 bits (210), Expect = 3e-16 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDLVEVPP VL +E+L AKR+E+VLEQAFEGGCPWRQH++L Sbjct: 366 LPERNLKDLVEVPPPVLGSLEILLAKRMEDVLEQAFEGGCPWRQHSKL 413 >XP_015867936.1 PREDICTED: lon protease homolog 2, peroxisomal [Ziziphus jujuba] Length = 782 Score = 85.5 bits (210), Expect = 4e-16 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDLVEVPP VL +E+L AKR+E+VLEQAFEGGCPWRQH++L Sbjct: 735 LPERNLKDLVEVPPPVLGSLEILLAKRMEDVLEQAFEGGCPWRQHSKL 782 >EPS62878.1 hypothetical protein M569_11910 [Genlisea aurea] Length = 886 Score = 85.5 bits (210), Expect = 5e-16 Identities = 37/48 (77%), Positives = 46/48 (95%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LP+RNLKDLVEVPPAVL+ +E+L AKR+E+VLEQAFEGGCPWR+H++L Sbjct: 839 LPDRNLKDLVEVPPAVLSNLEILVAKRMEDVLEQAFEGGCPWRRHSKL 886 >XP_007156606.1 hypothetical protein PHAVU_002G002800g [Phaseolus vulgaris] ESW28600.1 hypothetical protein PHAVU_002G002800g [Phaseolus vulgaris] Length = 73 Score = 78.2 bits (191), Expect = 6e-16 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDLVEVP +VL +E+LPAKR+EEVLE A +GGCPWRQ ++L Sbjct: 26 LPERNLKDLVEVPSSVLANLEILPAKRMEEVLEHALDGGCPWRQGSKL 73 >ONI06270.1 hypothetical protein PRUPE_5G050100 [Prunus persica] Length = 721 Score = 85.1 bits (209), Expect = 6e-16 Identities = 36/48 (75%), Positives = 46/48 (95%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDL+EVP AVL+G+E++ AKR+E+VLEQAF+GGCPWRQH++L Sbjct: 674 LPERNLKDLIEVPSAVLSGLEIIVAKRMEDVLEQAFDGGCPWRQHSKL 721 >XP_016648968.1 PREDICTED: lon protease homolog 2, peroxisomal [Prunus mume] Length = 869 Score = 85.1 bits (209), Expect = 6e-16 Identities = 36/48 (75%), Positives = 46/48 (95%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDL+EVP AVL+G+E++ AKR+E+VLEQAF+GGCPWRQH++L Sbjct: 822 LPERNLKDLIEVPSAVLSGLEIIVAKRMEDVLEQAFDGGCPWRQHSKL 869 >XP_007210904.1 hypothetical protein PRUPE_ppa001173mg [Prunus persica] ONI06269.1 hypothetical protein PRUPE_5G050100 [Prunus persica] Length = 888 Score = 85.1 bits (209), Expect = 6e-16 Identities = 36/48 (75%), Positives = 46/48 (95%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDL+EVP AVL+G+E++ AKR+E+VLEQAF+GGCPWRQH++L Sbjct: 841 LPERNLKDLIEVPSAVLSGLEIIVAKRMEDVLEQAFDGGCPWRQHSKL 888 >EYU17851.1 hypothetical protein MIMGU_mgv1a0010892mg, partial [Erythranthe guttata] Length = 208 Score = 81.6 bits (200), Expect = 7e-16 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERN KDL EVP AVL+ +E+L AKR+E+VLEQAFEGGCPWRQH++L Sbjct: 161 LPERNFKDLAEVPAAVLSSLEILLAKRMEDVLEQAFEGGCPWRQHSKL 208 >KZN04759.1 hypothetical protein DCAR_005596 [Daucus carota subsp. sativus] Length = 879 Score = 84.7 bits (208), Expect = 8e-16 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDLVEVP AVL ME+LPAKR+E+VLE AFEGGCPWRQ +RL Sbjct: 832 LPERNLKDLVEVPSAVLTSMEILPAKRMEDVLEHAFEGGCPWRQTSRL 879 >XP_020115147.1 lon protease homolog 2, peroxisomal [Ananas comosus] Length = 888 Score = 84.7 bits (208), Expect = 8e-16 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDL EVP A+L+GME+L KRIEEVLE AFEGGCPWR+HA+L Sbjct: 841 LPERNLKDLTEVPSAILSGMEILLVKRIEEVLEHAFEGGCPWRKHAKL 888 >XP_017235458.1 PREDICTED: lon protease homolog 2, peroxisomal-like [Daucus carota subsp. sativus] Length = 888 Score = 84.7 bits (208), Expect = 8e-16 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDLVEVP AVL ME+LPAKR+E+VLE AFEGGCPWRQ +RL Sbjct: 841 LPERNLKDLVEVPSAVLTSMEILPAKRMEDVLEHAFEGGCPWRQTSRL 888 >OAY77380.1 Lon protease, peroxisomal [Ananas comosus] Length = 888 Score = 84.7 bits (208), Expect = 8e-16 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDL EVP A+L+GME+L KRIEEVLE AFEGGCPWR+HA+L Sbjct: 841 LPERNLKDLTEVPSAILSGMEILLVKRIEEVLEHAFEGGCPWRKHAKL 888 >XP_009341221.1 PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 [Pyrus x bretschneideri] Length = 888 Score = 84.7 bits (208), Expect = 8e-16 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDL EVP AVL+G+E++ AKR+E+VLEQAFEGGCPWRQH++L Sbjct: 841 LPERNLKDLTEVPSAVLSGLEIILAKRMEDVLEQAFEGGCPWRQHSKL 888 >XP_008348469.1 PREDICTED: lon protease homolog 2, peroxisomal-like [Malus domestica] Length = 888 Score = 84.7 bits (208), Expect = 8e-16 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDL EVP AVL+G+E++ AKR+E+VLEQAFEGGCPWRQH++L Sbjct: 841 LPERNLKDLTEVPSAVLSGLEIILAKRMEDVLEQAFEGGCPWRQHSKL 888 >XP_010941244.1 PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 [Elaeis guineensis] Length = 894 Score = 84.7 bits (208), Expect = 8e-16 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +1 Query: 1 LPERNLKDLVEVPPAVLNGMEVLPAKRIEEVLEQAFEGGCPWRQHARL 144 LPERNLKDL EVP A+L GME+L KRIE+VLEQAFEGGCPWRQH++L Sbjct: 847 LPERNLKDLAEVPSAILAGMEILLVKRIEDVLEQAFEGGCPWRQHSKL 894