BLASTX nr result
ID: Magnolia22_contig00020654
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00020654 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAL03015.1 hypothetical protein IQ06DRAFT_345986 [Stagonospora s... 62 7e-10 >OAL03015.1 hypothetical protein IQ06DRAFT_345986 [Stagonospora sp. SRC1lsM3a] Length = 121 Score = 61.6 bits (148), Expect = 7e-10 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = +2 Query: 2 AFTPLALNAK-HAALPLPNLADMTPVARSAFLSNR 103 AFTPLALNAK HAA PLP+LADMTPVARSAFLSNR Sbjct: 86 AFTPLALNAKQHAAAPLPSLADMTPVARSAFLSNR 120