BLASTX nr result
ID: Magnolia22_contig00020416
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00020416 (328 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008719571.1 cytochrome c1, heme protein, mitochondrial [Cyphe... 64 1e-09 KFY51643.1 hypothetical protein V496_08802 [Pseudogymnoascus sp.... 58 1e-07 KFY22372.1 hypothetical protein V491_02818 [Pseudogymnoascus sp.... 58 1e-07 XP_016262726.1 cytochrome c1, heme protein, mitochondrial, varia... 57 1e-07 XP_016262725.1 cytochrome c1, heme protein, mitochondrial [Exoph... 57 2e-07 KIV78360.1 cytochrome c1, heme protein, mitochondrial [Exophiala... 57 3e-07 OJI96391.1 hypothetical protein ASPVEDRAFT_122274 [Aspergillus v... 57 4e-07 KEY76268.1 cytochrome c1/Cyt1 [Aspergillus fumigatus var. RP-2014] 57 4e-07 XP_749957.1 cytochrome C1/Cyt1 [Aspergillus fumigatus Af293] EAL... 57 4e-07 GAO89974.1 cytochrome c1, heme protein, mitochondrial [Aspergill... 57 4e-07 KFY25101.1 hypothetical protein V493_04843 [Pseudogymnoascus sp.... 56 5e-07 KPM38982.1 Cytochrome c1, heme protein, mitochondrial [Neonectri... 56 5e-07 XP_020057516.1 hypothetical protein ASPACDRAFT_115749 [Aspergill... 56 7e-07 OJJ62283.1 hypothetical protein ASPSYDRAFT_143844 [Aspergillus s... 56 7e-07 XP_657961.1 hypothetical protein AN0357.2 [Aspergillus nidulans ... 56 7e-07 KKK18697.1 cytochrome c1, mitochondrial precursor [Aspergillus r... 56 7e-07 KFZ13444.1 hypothetical protein V501_03700 [Pseudogymnoascus sp.... 56 7e-07 KFY96322.1 hypothetical protein V500_02517 [Pseudogymnoascus sp.... 56 7e-07 OBT77812.1 hypothetical protein VF21_03274 [Pseudogymnoascus sp.... 56 7e-07 OBT48756.1 hypothetical protein VE00_00802 [Pseudogymnoascus sp.... 56 7e-07 >XP_008719571.1 cytochrome c1, heme protein, mitochondrial [Cyphellophora europaea CBS 101466] ETN38982.1 cytochrome c1, heme protein, mitochondrial [Cyphellophora europaea CBS 101466] Length = 339 Score = 63.5 bits (153), Expect = 1e-09 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPPEEVKIRR 213 ++++ L LSIWVKRYKWSPVKTRKL Y+PP E K+RR Sbjct: 302 VVTSALFALSIWVKRYKWSPVKTRKLVYNPPAETKVRR 339 >KFY51643.1 hypothetical protein V496_08802 [Pseudogymnoascus sp. VKM F-4515 (FW-2607)] KFY93512.1 hypothetical protein V498_04380 [Pseudogymnoascus sp. VKM F-4517 (FW-2822)] Length = 316 Score = 58.2 bits (139), Expect = 1e-07 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPPE 231 I+++GLL LSIWVKRYKW+P+KTRK+ YSPP+ Sbjct: 279 IMTSGLLALSIWVKRYKWAPIKTRKIAYSPPK 310 >KFY22372.1 hypothetical protein V491_02818 [Pseudogymnoascus sp. VKM F-3775] Length = 316 Score = 58.2 bits (139), Expect = 1e-07 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPPE 231 I+++GLL LSIWVKRYKWSP+KTRK+ Y+PP+ Sbjct: 279 IMTSGLLALSIWVKRYKWSPIKTRKIAYNPPK 310 >XP_016262726.1 cytochrome c1, heme protein, mitochondrial, variant [Exophiala oligosperma] KIW42510.1 cytochrome c1, heme protein, mitochondrial, variant [Exophiala oligosperma] Length = 251 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPPEEVKIRR 213 II LL LS WVKRYKWSP+KTRKL Y+PP + ++RR Sbjct: 214 IIGVALLALSGWVKRYKWSPIKTRKLVYNPPIQGRVRR 251 >XP_016262725.1 cytochrome c1, heme protein, mitochondrial [Exophiala oligosperma] KIW42509.1 cytochrome c1, heme protein, mitochondrial [Exophiala oligosperma] Length = 321 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPPEEVKIRR 213 II LL LS WVKRYKWSP+KTRKL Y+PP + ++RR Sbjct: 284 IIGVALLALSGWVKRYKWSPIKTRKLVYNPPIQGRVRR 321 >KIV78360.1 cytochrome c1, heme protein, mitochondrial [Exophiala sideris] Length = 321 Score = 57.0 bits (136), Expect = 3e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPPEEVKIRR 213 II++ LL LS W+KRYKW+P+KTRK+ Y+PP E +IRR Sbjct: 284 IITSLLLALSGWMKRYKWAPIKTRKIVYNPPPETRIRR 321 >OJI96391.1 hypothetical protein ASPVEDRAFT_122274 [Aspergillus versicolor CBS 583.65] Length = 316 Score = 56.6 bits (135), Expect = 4e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 317 TGLLGLSIWVKRYKWSPVKTRKLKYSPP 234 TGL LS+WVKRYKWSP+KTRKL YSPP Sbjct: 285 TGLFALSVWVKRYKWSPIKTRKLVYSPP 312 >KEY76268.1 cytochrome c1/Cyt1 [Aspergillus fumigatus var. RP-2014] Length = 319 Score = 56.6 bits (135), Expect = 4e-07 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPP 234 +I TGL LS+WVKRYKW+P+KTRK+ YSPP Sbjct: 285 VILTGLFALSVWVKRYKWAPIKTRKIVYSPP 315 >XP_749957.1 cytochrome C1/Cyt1 [Aspergillus fumigatus Af293] EAL87919.1 cytochrome C1/Cyt1, putative [Aspergillus fumigatus Af293] EDP55550.1 cytochrome C1/Cyt1, putative [Aspergillus fumigatus A1163] KMK57518.1 cytochrome C1/Cyt1 [Aspergillus fumigatus Z5] Length = 319 Score = 56.6 bits (135), Expect = 4e-07 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPP 234 +I TGL LS+WVKRYKW+P+KTRK+ YSPP Sbjct: 285 VILTGLFALSVWVKRYKWAPIKTRKIVYSPP 315 >GAO89974.1 cytochrome c1, heme protein, mitochondrial [Aspergillus udagawae] Length = 332 Score = 56.6 bits (135), Expect = 4e-07 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPP 234 +I TGL LS+WVKRYKW+P+KTRK+ YSPP Sbjct: 298 VILTGLFALSVWVKRYKWAPIKTRKIVYSPP 328 >KFY25101.1 hypothetical protein V493_04843 [Pseudogymnoascus sp. VKM F-4281 (FW-2241)] Length = 316 Score = 56.2 bits (134), Expect = 5e-07 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPPE 231 I+S+ LL +SIWVKRYKW+P+KTRK+ YSPP+ Sbjct: 279 IMSSALLAISIWVKRYKWAPIKTRKIAYSPPK 310 >KPM38982.1 Cytochrome c1, heme protein, mitochondrial [Neonectria ditissima] Length = 322 Score = 56.2 bits (134), Expect = 5e-07 Identities = 21/38 (55%), Positives = 31/38 (81%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPPEEVKIRR 213 ++S L +S+WVKRYKW+ +K+RK+ Y PP+EVK+RR Sbjct: 285 VVSASLWAVSVWVKRYKWAWIKSRKIAYDPPKEVKVRR 322 >XP_020057516.1 hypothetical protein ASPACDRAFT_115749 [Aspergillus aculeatus ATCC 16872] OJK01177.1 hypothetical protein ASPACDRAFT_115749 [Aspergillus aculeatus ATCC 16872] Length = 316 Score = 55.8 bits (133), Expect = 7e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 317 TGLLGLSIWVKRYKWSPVKTRKLKYSPP 234 TGL LS+WVKRYKWSP+KTRK+ YSPP Sbjct: 285 TGLFALSVWVKRYKWSPIKTRKIVYSPP 312 >OJJ62283.1 hypothetical protein ASPSYDRAFT_143844 [Aspergillus sydowii CBS 593.65] Length = 316 Score = 55.8 bits (133), Expect = 7e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 317 TGLLGLSIWVKRYKWSPVKTRKLKYSPP 234 TGL LS+WVKRYKWSP+KTRK+ YSPP Sbjct: 285 TGLFALSVWVKRYKWSPIKTRKIVYSPP 312 >XP_657961.1 hypothetical protein AN0357.2 [Aspergillus nidulans FGSC A4] EAA65763.1 hypothetical protein AN0357.2 [Aspergillus nidulans FGSC A4] CBF89652.1 TPA: Ubiquinol-cytochrome c reductase (Eurofung) [Aspergillus nidulans FGSC A4] Length = 316 Score = 55.8 bits (133), Expect = 7e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 317 TGLLGLSIWVKRYKWSPVKTRKLKYSPP 234 TGL LS+WVKRYKWSP+KTRK+ YSPP Sbjct: 285 TGLFALSVWVKRYKWSPIKTRKIVYSPP 312 >KKK18697.1 cytochrome c1, mitochondrial precursor [Aspergillus rambellii] KKK23746.1 cytochrome c1, mitochondrial precursor [Aspergillus ochraceoroseus] Length = 316 Score = 55.8 bits (133), Expect = 7e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 317 TGLLGLSIWVKRYKWSPVKTRKLKYSPP 234 TGL LS+WVKRYKWSP+KTRK+ YSPP Sbjct: 285 TGLFALSVWVKRYKWSPIKTRKIVYSPP 312 >KFZ13444.1 hypothetical protein V501_03700 [Pseudogymnoascus sp. VKM F-4519 (FW-2642)] Length = 316 Score = 55.8 bits (133), Expect = 7e-07 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPPE 231 I+S+ LL LSIWVKRYKW+P+KTRK+ Y+PP+ Sbjct: 279 IMSSALLALSIWVKRYKWAPIKTRKIAYNPPK 310 >KFY96322.1 hypothetical protein V500_02517 [Pseudogymnoascus sp. VKM F-4518 (FW-2643)] KFZ11598.1 hypothetical protein V502_07486 [Pseudogymnoascus sp. VKM F-4520 (FW-2644)] Length = 316 Score = 55.8 bits (133), Expect = 7e-07 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPPE 231 I+S+ LL LSIWVKRYKW+P+KTRK+ Y+PP+ Sbjct: 279 IMSSALLALSIWVKRYKWAPIKTRKIAYNPPK 310 >OBT77812.1 hypothetical protein VF21_03274 [Pseudogymnoascus sp. 05NY08] OBT90122.1 hypothetical protein VE02_00893 [Pseudogymnoascus sp. 03VT05] Length = 318 Score = 55.8 bits (133), Expect = 7e-07 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPPE 231 I+S+ LL LSIWVKRYKW+P+KTRK+ Y+PP+ Sbjct: 281 IMSSALLALSIWVKRYKWAPIKTRKIAYNPPK 312 >OBT48756.1 hypothetical protein VE00_00802 [Pseudogymnoascus sp. WSF 3629] Length = 318 Score = 55.8 bits (133), Expect = 7e-07 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -3 Query: 326 IISTGLLGLSIWVKRYKWSPVKTRKLKYSPPE 231 I+S+ LL LSIWVKRYKW+P+KTRK+ Y+PP+ Sbjct: 281 IMSSALLALSIWVKRYKWAPIKTRKIAYNPPK 312