BLASTX nr result
ID: Magnolia22_contig00019455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00019455 (496 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010101382.1 Protein IQ-DOMAIN 14 [Morus notabilis] EXB88329.1... 63 2e-08 CBI24678.3 unnamed protein product, partial [Vitis vinifera] 57 1e-06 XP_018852320.1 PREDICTED: protein IQ-DOMAIN 14 isoform X1 [Jugla... 57 1e-06 XP_002276507.1 PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera] 57 1e-06 XP_008222492.1 PREDICTED: protein IQ-DOMAIN 14 isoform X1 [Prunu... 57 1e-06 XP_006366143.1 PREDICTED: protein IQ-DOMAIN 14-like [Solanum tub... 57 2e-06 XP_015085670.1 PREDICTED: protein IQ-DOMAIN 14-like [Solanum pen... 57 2e-06 NP_001311008.1 short calmodulin-binding motif-containing protein... 57 2e-06 XP_006442777.1 hypothetical protein CICLE_v10022339mg [Citrus cl... 54 6e-06 >XP_010101382.1 Protein IQ-DOMAIN 14 [Morus notabilis] EXB88329.1 Protein IQ-DOMAIN 14 [Morus notabilis] Length = 717 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +2 Query: 371 ER*SNARSMGKKSSWLSAIKRVFTPNSKEKLVHGSEKKGVKE 496 E+ SNAR+MGKK SW SAIKRVFTP+SKEK V+ SEKK KE Sbjct: 184 EKKSNARNMGKKGSWFSAIKRVFTPHSKEKPVNDSEKKTTKE 225 >CBI24678.3 unnamed protein product, partial [Vitis vinifera] Length = 435 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 395 MGKKSSWLSAIKRVFTPNSKEKLVHGSEKKGVKE 496 MGKK SW SAIKRVF PNSKEKLV+G+E+K KE Sbjct: 1 MGKKGSWFSAIKRVFIPNSKEKLVNGTERKNAKE 34 >XP_018852320.1 PREDICTED: protein IQ-DOMAIN 14 isoform X1 [Juglans regia] Length = 532 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +2 Query: 380 SNARSMGKKSSWLSAIKRVFTPNSKEKLVHGSEKKGVKE 496 SNAR MGKK SW SAIKRVF P+SK K V+ SEKK KE Sbjct: 5 SNARDMGKKGSWFSAIKRVFIPHSKAKPVNDSEKKSTKE 43 >XP_002276507.1 PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera] Length = 535 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 395 MGKKSSWLSAIKRVFTPNSKEKLVHGSEKKGVKE 496 MGKK SW SAIKRVF PNSKEKLV+G+E+K KE Sbjct: 1 MGKKGSWFSAIKRVFIPNSKEKLVNGTERKNAKE 34 >XP_008222492.1 PREDICTED: protein IQ-DOMAIN 14 isoform X1 [Prunus mume] Length = 537 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 395 MGKKSSWLSAIKRVFTPNSKEKLVHGSEKKGVKE 496 MGKK SW SAIKRVF+P+SKEK+V+GSEKK KE Sbjct: 1 MGKKGSWFSAIKRVFSPHSKEKVVNGSEKKNTKE 34 >XP_006366143.1 PREDICTED: protein IQ-DOMAIN 14-like [Solanum tuberosum] Length = 535 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 395 MGKKSSWLSAIKRVFTPNSKEKLVHGSEKKGVKE 496 MGKK SW SAIKRVFTP+SKEKL + SEKKG KE Sbjct: 1 MGKKGSWFSAIKRVFTPSSKEKLPNESEKKGAKE 34 >XP_015085670.1 PREDICTED: protein IQ-DOMAIN 14-like [Solanum pennellii] Length = 539 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 395 MGKKSSWLSAIKRVFTPNSKEKLVHGSEKKGVKE 496 MGKK SW SAIKRVFTP+SKEKL + SEKKG KE Sbjct: 1 MGKKGSWFSAIKRVFTPSSKEKLPNESEKKGAKE 34 >NP_001311008.1 short calmodulin-binding motif-containing protein [Solanum lycopersicum] Length = 539 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 395 MGKKSSWLSAIKRVFTPNSKEKLVHGSEKKGVKE 496 MGKK SW SAIKRVFTP+SKEKL + SEKKG KE Sbjct: 1 MGKKGSWFSAIKRVFTPSSKEKLPNESEKKGAKE 34 >XP_006442777.1 hypothetical protein CICLE_v10022339mg [Citrus clementina] XP_006442778.1 hypothetical protein CICLE_v10022339mg [Citrus clementina] ESR56017.1 hypothetical protein CICLE_v10022339mg [Citrus clementina] ESR56018.1 hypothetical protein CICLE_v10022339mg [Citrus clementina] Length = 198 Score = 54.3 bits (129), Expect = 6e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +2 Query: 395 MGKKSSWLSAIKRVFTPNSKEKLVHGSEKKGVKE 496 MGKK SW SAIKRVFTP+SKEKL + S+KK KE Sbjct: 1 MGKKGSWFSAIKRVFTPHSKEKLANESDKKSTKE 34