BLASTX nr result
ID: Magnolia22_contig00019333
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00019333 (503 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008716642.1 thioredoxin [Cyphellophora europaea CBS 101466] E... 70 4e-12 KIW64319.1 thioredoxin [Capronia semi-immersa] 70 4e-12 XP_007776414.1 hypothetical protein W97_00308 [Coniosporium apol... 67 3e-11 XP_016225564.1 thioredoxin, variant [Exophiala mesophila] KIV939... 66 5e-11 OCT44987.1 Thioredoxin [Cladophialophora carrionii] 67 6e-11 XP_016637913.1 hypothetical protein Z520_00482 [Fonsecaea multim... 67 6e-11 XP_008730195.1 thioredoxin [Cladophialophora carrionii CBS 160.5... 67 6e-11 XP_016225563.1 thioredoxin [Exophiala mesophila] KIV93989.1 thio... 66 1e-10 XP_016260461.1 thioredoxin, variant [Exophiala oligosperma] KIW4... 64 2e-10 XP_009153143.1 thioredoxin 1 [Exophiala dermatitidis NIH/UT8656]... 64 2e-10 XP_016614177.1 thioredoxin [Cladophialophora bantiana CBS 173.52... 65 2e-10 XP_007740244.1 thioredoxin 1 [Cladophialophora psammophila CBS 1... 65 2e-10 GAM85032.1 hypothetical protein ANO11243_030350 [fungal sp. No.1... 64 4e-10 XP_016232179.1 thioredoxin [Exophiala spinifera] KIW11963.1 thio... 65 4e-10 XP_016260460.1 thioredoxin [Exophiala oligosperma] KIW40244.1 th... 64 5e-10 XP_017995051.1 Thioredoxin [Phialophora attae] KPI35088.1 Thiore... 64 5e-10 XP_013320902.1 thioredoxin [Exophiala xenobiotica] KIW60318.1 th... 64 6e-10 XP_016253959.1 thioredoxin, variant [Cladophialophora immunda] K... 63 6e-10 XP_007722014.1 thioredoxin 1 [Capronia coronata CBS 617.96] EXJ9... 64 6e-10 XP_007760865.1 hypothetical protein A1O7_08685 [Cladophialophora... 64 8e-10 >XP_008716642.1 thioredoxin [Cyphellophora europaea CBS 101466] ETN42133.1 thioredoxin [Cyphellophora europaea CBS 101466] Length = 140 Score = 69.7 bits (169), Expect = 4e-12 Identities = 37/67 (55%), Positives = 44/67 (65%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 V MS EE Y DE P VAQE GIRAMPTF ++KNGE+V E+VGANE+A+R Sbjct: 74 VSAMSQEEKYKDSVDFYKIDVDEVPDVAQELGIRAMPTFLVFKNGEQVEEIVGANERAIR 133 Query: 321 AKIDSLL 301 A +D L Sbjct: 134 AAVDKHL 140 >KIW64319.1 thioredoxin [Capronia semi-immersa] Length = 141 Score = 69.7 bits (169), Expect = 4e-12 Identities = 37/67 (55%), Positives = 42/67 (62%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 V+K SN E Y DEAP VAQE G+RAMPTF +KNGEKV EVVGAN +AL Sbjct: 75 VLKFSNSEQYKDKVEFYKVDVDEAPDVAQELGVRAMPTFMFFKNGEKVAEVVGANVRALE 134 Query: 321 AKIDSLL 301 A I + Sbjct: 135 ANIQKFM 141 >XP_007776414.1 hypothetical protein W97_00308 [Coniosporium apollinis CBS 100218] EON61097.1 hypothetical protein W97_00308 [Coniosporium apollinis CBS 100218] Length = 110 Score = 66.6 bits (161), Expect = 3e-11 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 435 EAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALRAKIDSLL 301 E P+VAQE GIRAMPTF ++KNGEKVGEVVGAN KAL A I S L Sbjct: 64 EVPEVAQELGIRAMPTFLLFKNGEKVGEVVGANPKALEAAIKSNL 108 >XP_016225564.1 thioredoxin, variant [Exophiala mesophila] KIV93990.1 thioredoxin, variant [Exophiala mesophila] Length = 110 Score = 65.9 bits (159), Expect = 5e-11 Identities = 35/67 (52%), Positives = 43/67 (64%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 V K S E + DE P VAQE G+RAMPTF ++K GEKVGEVVGA+++ALR Sbjct: 44 VAKFSESEEFKDKVDFYKVDVDEVPDVAQELGVRAMPTFMLFKGGEKVGEVVGADKRALR 103 Query: 321 AKIDSLL 301 A I+ L Sbjct: 104 AAIEKNL 110 >OCT44987.1 Thioredoxin [Cladophialophora carrionii] Length = 141 Score = 66.6 bits (161), Expect = 6e-11 Identities = 36/63 (57%), Positives = 40/63 (63%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 V+K SN E Y DE P VAQE G+RAMPTF +KNGEKV EVVGAN +AL Sbjct: 75 VLKFSNSEQYKDKVDFYKVDVDEVPDVAQELGVRAMPTFMFFKNGEKVDEVVGANVRALE 134 Query: 321 AKI 313 A I Sbjct: 135 AAI 137 >XP_016637913.1 hypothetical protein Z520_00482 [Fonsecaea multimorphosa CBS 102226] KIY03791.1 hypothetical protein Z520_00482 [Fonsecaea multimorphosa CBS 102226] OAL32483.1 hypothetical protein AYO22_00505 [Fonsecaea multimorphosa] Length = 141 Score = 66.6 bits (161), Expect = 6e-11 Identities = 36/63 (57%), Positives = 40/63 (63%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 V K S +AY DE P VAQE G+RAMPTF I+KNGEKV EVVGAN+ AL Sbjct: 75 VAKFSESDAYKDRVDFYKVDVDEVPDVAQELGVRAMPTFMIFKNGEKVDEVVGANKNALE 134 Query: 321 AKI 313 A I Sbjct: 135 AAI 137 >XP_008730195.1 thioredoxin [Cladophialophora carrionii CBS 160.54] ETI21314.1 thioredoxin [Cladophialophora carrionii CBS 160.54] Length = 141 Score = 66.6 bits (161), Expect = 6e-11 Identities = 36/63 (57%), Positives = 40/63 (63%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 V+K SN E Y DE P VAQE G+RAMPTF +KNGEKV EVVGAN +AL Sbjct: 75 VLKFSNSEQYKDKVDFYKVDVDEVPDVAQELGVRAMPTFMFFKNGEKVDEVVGANVRALE 134 Query: 321 AKI 313 A I Sbjct: 135 AAI 137 >XP_016225563.1 thioredoxin [Exophiala mesophila] KIV93989.1 thioredoxin [Exophiala mesophila] Length = 148 Score = 65.9 bits (159), Expect = 1e-10 Identities = 35/67 (52%), Positives = 43/67 (64%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 V K S E + DE P VAQE G+RAMPTF ++K GEKVGEVVGA+++ALR Sbjct: 82 VAKFSESEEFKDKVDFYKVDVDEVPDVAQELGVRAMPTFMLFKGGEKVGEVVGADKRALR 141 Query: 321 AKIDSLL 301 A I+ L Sbjct: 142 AAIEKNL 148 >XP_016260461.1 thioredoxin, variant [Exophiala oligosperma] KIW40245.1 thioredoxin, variant [Exophiala oligosperma] Length = 110 Score = 64.3 bits (155), Expect = 2e-10 Identities = 34/63 (53%), Positives = 40/63 (63%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 VVK S + DE P VAQE G+RAMPTF ++KNGEKVGEVVGAN++AL Sbjct: 44 VVKFSESPEFKDKVDFYKIDVDEVPDVAQELGVRAMPTFMLFKNGEKVGEVVGANKRALE 103 Query: 321 AKI 313 I Sbjct: 104 QAI 106 >XP_009153143.1 thioredoxin 1 [Exophiala dermatitidis NIH/UT8656] EHY52682.1 thioredoxin 1 [Exophiala dermatitidis NIH/UT8656] Length = 110 Score = 64.3 bits (155), Expect = 2e-10 Identities = 34/67 (50%), Positives = 43/67 (64%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 +VK S + + DE P VAQE G+RAMPTF ++KNG+KVGEVVGAN++AL Sbjct: 44 LVKFSESDEFKDKVDFYKIDVDEVPDVAQELGVRAMPTFMLFKNGQKVGEVVGANKRALE 103 Query: 321 AKIDSLL 301 I S L Sbjct: 104 QAIRSNL 110 >XP_016614177.1 thioredoxin [Cladophialophora bantiana CBS 173.52] KIW87508.1 thioredoxin [Cladophialophora bantiana CBS 173.52] Length = 141 Score = 65.1 bits (157), Expect = 2e-10 Identities = 35/63 (55%), Positives = 40/63 (63%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 V K S + + DE P VAQE G+RAMPTF I+KNGEKVGEVVGAN+ AL Sbjct: 75 VAKFSESDDFKDKVDFYKVDVDEVPDVAQELGVRAMPTFMIFKNGEKVGEVVGANKHALE 134 Query: 321 AKI 313 A I Sbjct: 135 AAI 137 >XP_007740244.1 thioredoxin 1 [Cladophialophora psammophila CBS 110553] EXJ74742.1 thioredoxin 1 [Cladophialophora psammophila CBS 110553] Length = 141 Score = 65.1 bits (157), Expect = 2e-10 Identities = 35/63 (55%), Positives = 40/63 (63%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 V K S + + DE P VAQE G+RAMPTF I+KNGEKVGEVVGAN+ AL Sbjct: 75 VAKFSESDDFKDKVDFYKVDVDEVPDVAQELGVRAMPTFMIFKNGEKVGEVVGANKHALE 134 Query: 321 AKI 313 A I Sbjct: 135 AAI 137 >GAM85032.1 hypothetical protein ANO11243_030350 [fungal sp. No.11243] Length = 105 Score = 63.5 bits (153), Expect = 4e-10 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = -3 Query: 435 EAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALRAKIDSLL 301 E P VAQE GIRAMPTF ++KNGEKVGEVVGAN KAL + I L Sbjct: 61 EVPDVAQELGIRAMPTFLLFKNGEKVGEVVGANPKALESAIQGNL 105 >XP_016232179.1 thioredoxin [Exophiala spinifera] KIW11963.1 thioredoxin [Exophiala spinifera] Length = 153 Score = 64.7 bits (156), Expect = 4e-10 Identities = 35/67 (52%), Positives = 42/67 (62%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 VVK S + DE P VAQE G+RAMPTF ++KNGEKVGEVVGAN++AL Sbjct: 87 VVKFSESPEFKDKVAFYKIDVDEVPDVAQELGVRAMPTFMLFKNGEKVGEVVGANKRALE 146 Query: 321 AKIDSLL 301 I + L Sbjct: 147 QAIKANL 153 >XP_016260460.1 thioredoxin [Exophiala oligosperma] KIW40244.1 thioredoxin [Exophiala oligosperma] Length = 144 Score = 64.3 bits (155), Expect = 5e-10 Identities = 34/63 (53%), Positives = 40/63 (63%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 VVK S + DE P VAQE G+RAMPTF ++KNGEKVGEVVGAN++AL Sbjct: 78 VVKFSESPEFKDKVDFYKIDVDEVPDVAQELGVRAMPTFMLFKNGEKVGEVVGANKRALE 137 Query: 321 AKI 313 I Sbjct: 138 QAI 140 >XP_017995051.1 Thioredoxin [Phialophora attae] KPI35088.1 Thioredoxin [Phialophora attae] Length = 136 Score = 63.9 bits (154), Expect = 5e-10 Identities = 35/67 (52%), Positives = 42/67 (62%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 + +MS E+ Y DE VA E IRAMPTF ++KNGEKV EVVGANEKA+R Sbjct: 70 IAQMSGEDKYKDAVDFYKLDVDEVSDVAAELEIRAMPTFLVFKNGEKVEEVVGANEKAIR 129 Query: 321 AKIDSLL 301 A +D L Sbjct: 130 AALDKHL 136 >XP_013320902.1 thioredoxin [Exophiala xenobiotica] KIW60318.1 thioredoxin [Exophiala xenobiotica] Length = 139 Score = 63.9 bits (154), Expect = 6e-10 Identities = 33/63 (52%), Positives = 40/63 (63%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 +VK S + DE P +AQE G+RAMPTF ++KNGEKVGEVVGAN+KAL Sbjct: 73 LVKFSESPEFKDKVAFYKIDVDEVPDIAQELGVRAMPTFMLFKNGEKVGEVVGANKKALE 132 Query: 321 AKI 313 I Sbjct: 133 QAI 135 >XP_016253959.1 thioredoxin, variant [Cladophialophora immunda] KIW33743.1 thioredoxin, variant [Cladophialophora immunda] Length = 110 Score = 63.2 bits (152), Expect = 6e-10 Identities = 35/67 (52%), Positives = 41/67 (61%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 V K S + + DE P VAQE G+RAMPTF I+KNGEKV EVVGAN++AL Sbjct: 44 VAKFSESDDFKDKVDFYKVDVDEVPDVAQELGVRAMPTFMIFKNGEKVAEVVGANKRALE 103 Query: 321 AKIDSLL 301 I S L Sbjct: 104 QAIRSNL 110 >XP_007722014.1 thioredoxin 1 [Capronia coronata CBS 617.96] EXJ94520.1 thioredoxin 1 [Capronia coronata CBS 617.96] Length = 159 Score = 64.3 bits (155), Expect = 6e-10 Identities = 34/63 (53%), Positives = 40/63 (63%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 +VK S E + DE P VAQE G+RAMPTF ++KNGEKV EVVGAN+KAL Sbjct: 93 LVKFSESEEFKDKVDFYKIDVDEVPDVAQELGVRAMPTFMLFKNGEKVAEVVGANKKALE 152 Query: 321 AKI 313 I Sbjct: 153 QAI 155 >XP_007760865.1 hypothetical protein A1O7_08685 [Cladophialophora yegresii CBS 114405] EXJ55755.1 hypothetical protein A1O7_08685 [Cladophialophora yegresii CBS 114405] Length = 142 Score = 63.5 bits (153), Expect = 8e-10 Identities = 34/63 (53%), Positives = 40/63 (63%) Frame = -3 Query: 501 VVKMSNEEAYXXXXXXXXXXXDEAPQVAQEEGIRAMPTFGIYKNGEKVGEVVGANEKALR 322 V+K SN + Y DE P VAQE G+RAMPTF +KNGEKV EVVGA+ +AL Sbjct: 76 VLKFSNSDEYKDKVDFYKVDVDEVPDVAQELGVRAMPTFMFFKNGEKVDEVVGADVRALE 135 Query: 321 AKI 313 A I Sbjct: 136 AAI 138