BLASTX nr result
ID: Magnolia22_contig00018986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00018986 (373 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017997882.1 Uracil catabolism protein 4 [Phialophora attae] K... 79 1e-14 OCT52655.1 Uracil catabolism protein 4 [Cladophialophora carrionii] 79 1e-14 KIW68696.1 hypothetical protein PV04_04620 [Capronia semi-immersa] 79 1e-14 XP_008726608.1 hypothetical protein G647_04041 [Cladophialophora... 79 1e-14 XP_013276818.1 hypothetical protein Z518_00763 [Rhinocladiella m... 79 1e-14 XP_013257387.1 hypothetical protein A1O9_09239 [Exophiala aquama... 78 3e-14 XP_008721321.1 hypothetical protein HMPREF1541_08781 [Cyphelloph... 76 1e-13 OAG42534.1 hypothetical protein AYO21_03119 [Fonsecaea monophora] 76 1e-13 OAL38140.1 hypothetical protein AYO20_02592 [Fonsecaea nubica] 76 1e-13 XP_016617259.1 hypothetical protein Z519_08373 [Cladophialophora... 76 1e-13 XP_013283746.1 hypothetical protein Z517_06553 [Fonsecaea pedros... 76 1e-13 XP_016250062.1 hypothetical protein PV07_05633 [Cladophialophora... 76 1e-13 KIV86172.1 hypothetical protein PV11_01802 [Exophiala sideris] 76 1e-13 XP_007720931.1 hypothetical protein A1O1_01829 [Capronia coronat... 76 1e-13 XP_007739903.1 hypothetical protein A1O5_01094 [Cladophialophora... 76 1e-13 XP_018694998.1 hypothetical protein AYL99_03834 [Fonsecaea erect... 76 1e-13 XP_016626644.1 hypothetical protein Z520_11841 [Fonsecaea multim... 75 2e-13 XP_009155595.1 hypothetical protein HMPREF1120_03286 [Exophiala ... 75 3e-13 XP_016232332.1 hypothetical protein PV08_09390 [Exophiala spinif... 74 5e-13 XP_013318255.1 hypothetical protein PV05_02237 [Exophiala xenobi... 74 5e-13 >XP_017997882.1 Uracil catabolism protein 4 [Phialophora attae] KPI37919.1 Uracil catabolism protein 4 [Phialophora attae] Length = 490 Score = 78.6 bits (192), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF Sbjct: 454 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 490 >OCT52655.1 Uracil catabolism protein 4 [Cladophialophora carrionii] Length = 503 Score = 78.6 bits (192), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF Sbjct: 467 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 503 >KIW68696.1 hypothetical protein PV04_04620 [Capronia semi-immersa] Length = 503 Score = 78.6 bits (192), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF Sbjct: 467 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 503 >XP_008726608.1 hypothetical protein G647_04041 [Cladophialophora carrionii CBS 160.54] ETI24672.1 hypothetical protein G647_04041 [Cladophialophora carrionii CBS 160.54] Length = 503 Score = 78.6 bits (192), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF Sbjct: 467 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 503 >XP_013276818.1 hypothetical protein Z518_00763 [Rhinocladiella mackenziei CBS 650.93] KIX09682.1 hypothetical protein Z518_00763 [Rhinocladiella mackenziei CBS 650.93] Length = 506 Score = 78.6 bits (192), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF Sbjct: 470 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 506 >XP_013257387.1 hypothetical protein A1O9_09239 [Exophiala aquamarina CBS 119918] KEF54797.1 hypothetical protein A1O9_09239 [Exophiala aquamarina CBS 119918] Length = 508 Score = 77.8 bits (190), Expect = 3e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGRE+AQVSRPITKGPPIGIISDGTVF Sbjct: 472 AQMLEAGTWKGGRELAQVSRPITKGPPIGIISDGTVF 508 >XP_008721321.1 hypothetical protein HMPREF1541_08781 [Cyphellophora europaea CBS 101466] ETN36503.1 hypothetical protein HMPREF1541_08781 [Cyphellophora europaea CBS 101466] Length = 503 Score = 76.3 bits (186), Expect = 1e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWK GREIAQVSRPITKGPPIGIISDGTVF Sbjct: 467 AQMLEAGTWKSGREIAQVSRPITKGPPIGIISDGTVF 503 >OAG42534.1 hypothetical protein AYO21_03119 [Fonsecaea monophora] Length = 450 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPIT GPPIGIISDGTVF Sbjct: 414 AQMLEAGTWKGGREIAQVSRPITGGPPIGIISDGTVF 450 >OAL38140.1 hypothetical protein AYO20_02592 [Fonsecaea nubica] Length = 506 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPIT GPPIGIISDGTVF Sbjct: 470 AQMLEAGTWKGGREIAQVSRPITGGPPIGIISDGTVF 506 >XP_016617259.1 hypothetical protein Z519_08373 [Cladophialophora bantiana CBS 173.52] KIW90590.1 hypothetical protein Z519_08373 [Cladophialophora bantiana CBS 173.52] Length = 506 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPIT GPPIGIISDGTVF Sbjct: 470 AQMLEAGTWKGGREIAQVSRPITGGPPIGIISDGTVF 506 >XP_013283746.1 hypothetical protein Z517_06553 [Fonsecaea pedrosoi CBS 271.37] KIW79938.1 hypothetical protein Z517_06553 [Fonsecaea pedrosoi CBS 271.37] Length = 506 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPIT GPPIGIISDGTVF Sbjct: 470 AQMLEAGTWKGGREIAQVSRPITGGPPIGIISDGTVF 506 >XP_016250062.1 hypothetical protein PV07_05633 [Cladophialophora immunda] KIW29846.1 hypothetical protein PV07_05633 [Cladophialophora immunda] Length = 506 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPIT GPPIGIISDGTVF Sbjct: 470 AQMLEAGTWKGGREIAQVSRPITGGPPIGIISDGTVF 506 >KIV86172.1 hypothetical protein PV11_01802 [Exophiala sideris] Length = 506 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPIT GPPIGIISDGTVF Sbjct: 470 AQMLEAGTWKGGREIAQVSRPITGGPPIGIISDGTVF 506 >XP_007720931.1 hypothetical protein A1O1_01829 [Capronia coronata CBS 617.96] EXJ93437.1 hypothetical protein A1O1_01829 [Capronia coronata CBS 617.96] Length = 506 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPIT GPPIGIISDGTVF Sbjct: 470 AQMLEAGTWKGGREIAQVSRPITGGPPIGIISDGTVF 506 >XP_007739903.1 hypothetical protein A1O5_01094 [Cladophialophora psammophila CBS 110553] EXJ76586.1 hypothetical protein A1O5_01094 [Cladophialophora psammophila CBS 110553] Length = 506 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPIT GPPIGIISDGTVF Sbjct: 470 AQMLEAGTWKGGREIAQVSRPITGGPPIGIISDGTVF 506 >XP_018694998.1 hypothetical protein AYL99_03834 [Fonsecaea erecta] OAP61631.1 hypothetical protein AYL99_03834 [Fonsecaea erecta] Length = 507 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQVSRPIT GPPIGIISDGTVF Sbjct: 471 AQMLEAGTWKGGREIAQVSRPITGGPPIGIISDGTVF 507 >XP_016626644.1 hypothetical protein Z520_11841 [Fonsecaea multimorphosa CBS 102226] KIX92521.1 hypothetical protein Z520_11841 [Fonsecaea multimorphosa CBS 102226] OAL19633.1 hypothetical protein AYO22_09795 [Fonsecaea multimorphosa] Length = 506 Score = 75.5 bits (184), Expect = 2e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGRE+AQVSRPIT GPPIGIISDGTVF Sbjct: 470 AQMLEAGTWKGGREVAQVSRPITGGPPIGIISDGTVF 506 >XP_009155595.1 hypothetical protein HMPREF1120_03286 [Exophiala dermatitidis NIH/UT8656] EHY55134.1 hypothetical protein HMPREF1120_03286 [Exophiala dermatitidis NIH/UT8656] Length = 505 Score = 74.7 bits (182), Expect = 3e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIAQ+SRPIT GPPIGIISDGTVF Sbjct: 469 AQMLEAGTWKGGREIAQMSRPITGGPPIGIISDGTVF 505 >XP_016232332.1 hypothetical protein PV08_09390 [Exophiala spinifera] KIW12116.1 hypothetical protein PV08_09390 [Exophiala spinifera] Length = 502 Score = 74.3 bits (181), Expect = 5e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIA+VSRPIT GPPIGIISDGTVF Sbjct: 466 AQMLEAGTWKGGREIAKVSRPITGGPPIGIISDGTVF 502 >XP_013318255.1 hypothetical protein PV05_02237 [Exophiala xenobiotica] KIW57671.1 hypothetical protein PV05_02237 [Exophiala xenobiotica] Length = 506 Score = 74.3 bits (181), Expect = 5e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 373 AQMLEAGTWKGGREIAQVSRPITKGPPIGIISDGTVF 263 AQMLEAGTWKGGREIA+VSRPIT GPPIGIISDGTVF Sbjct: 470 AQMLEAGTWKGGREIAKVSRPITGGPPIGIISDGTVF 506